censored pov javcensored school uniform creampie




FC2ABWJULGMEMAWDHODVSSISWANZEBODMIAANACXROYDMIDVHMNMEYDMILKADNDASDFSDSSRBDAPOD

2021-01-01
31 min

359TYVM-117 Ripe De M Wife Husband Official NTR Cum Inside Sex! !!

  • amateur censoredcreampiemarried womantyvmtyvm-117tyvm117359tyvm-117
    • 2021-01-02
    78 min

    [opcyn-140]ゆりあ 3(28)

  • amateur censoredbig titsamateuropcynopcyn-140opcyn140opcyn-140
    • 2021-01-03
    77 min

    200GANA-2419 Seriously Nampa, first shot. 1578 A busty beautiful girl who came to see her boyfriend who is in love for a long distance from Kagoshima all the way, found in Shinjuku! Bring the boyfriend to the hotel where he is in trouble because he l

  • amateur censoredbig titssquirtingganagana-2419gana2419200gana-2419
    • 2021-01-08
    209 min

    [NHDTB-479]Drool Dripping Down! Pussy Juices Gushing! Passionate Lesbian Cunnilingus With A S********l 2

  • censoredschoolgirllesbianNHDTBnatural highvanilla sakuraiNHDTB-479NHDTB4791nhdtb00479
    • 2021-01-12
    50 min

    H4610 ki210112 Eri Maeda 19years old

  • amateur uncensoredh4610
    • 2021-02-10
    80 min

    [ETQR-195][Daydream POV] Skipping Work To Have Sex On The Clock With That Cute Coworker In Hotel Room - Ms. Tojo, 24

  • censoredcreampieuniformETQRerotic timeETQR-195ETQR195h-1186etqr00195
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-15
    49 min

    FC2PPV 1687864 [First time limited 1980] That natural beauty big breasts G cup ❤️ The size of the boobs has increased ❤️ H cup fair body ❤️ A large amount of vaginal cum shot again in a very narrow pussy ❤️ * Review privilege “Squirting challeng

  • amateur uncensoredfc2
    • 2021-02-26
    78 min

    300MAAN-628 [Unconscious little devil girl / maid clothes x Gonzo / Creampie & Facials] Moe voice of Lori system x Mechakawa girls bar clerk who naturally tosses a man with a good eye! !! It’s a neat and clean JD with a perfect appearance an

  • amateur censoredcreampieamateurmaanmaan-628maan628300maan-628
    • 2021-03-02
    56 min

    345SIMM-614 Big butt bullet cowgirl that defenseless character can not be alert

  • amateur censoredcreampieuniformsimmsimm-614simm614345simm-614
    • 2021-03-27
    144 min

    [XVSR-583]S&M Breaking In Document: Loving Ropes - AIZYO - Ichika Saijo

  • ichibana mogami hana sato censoreddeepthroatbdsmXVSRmax asuisei akaicalenXVSR-583XVSR583xvsr00583
    • 2021-04-06
    26 min

    FC2PPV 1757073 Sale until 4/12! [Reverse NTR outflow] Hidden camera taken by a woman / J.K who tears off the forbidden love with a married teacher / True Icharab sex * Benefits with review + message

  • amateur uncensoredfc2
    • 2021-04-09
    115 min

    [IPX-641]I Hope My Husband Never Finds Out - Today I'm Being Ravished By My Father-In-Law Again. He Keeps Making Me Cum... Karen Kaede

  • karen kaede censoreddeepthroatsingle workIPXidea pocketshiro shotendishIPX-641IPX641ipx00641
    • 2021-04-09
    99 min

    374IMGN-002 MIYU(28)

  • amateur censoredmarried womanamateurimgnimgn-002imgn002374imgn-002
    • 2021-04-17
    181 min

    [AKID-083]@I Started My Sex Life!! #Takehome vol. 2

  • censoredAKIDomochikaeri mousozokumanji groupAKID-083AKID083akid00083
    • 2021-04-24
    71 min

    300NTK-558 A miracle combination! ？？ Orthodox beautiful girl x hikikomori x transcendental style = superb P activity experience! !! Hikikomori’s libido is incomplete! !! Let’s take a look at the complete foolery of a beautiful girl who spri

  • amateur censoredcreampieamateurntkntk-558ntk558300ntk-558
    • 2021-05-07
    148 min

    [JUFE-287]Rena-chan Was Wearing A Sexy Costume At Her Booth At The School Fair And It Caused A Major Panic! She Was Exposing Her Colossal Tits And Pussy During Some Excessively Filthy Reverse Bunny Girl Customer Service Rena Momozono

  • reina taoyuan censoredbig titsschoolgirlJUFEfitchJUFE-287JUFE287jufe00287
    • 2021-05-10
    99 min

    300MIUM-707 Big Cock 100 Slashing Big Butt Wife! !! !! [Dirty wife caught for big dick] → Ji ● If you ask me to get up, [Shake the big cock and show off a thick dildo masturbation! ] Gingin erection Chi ● Sucking on Po! !! Raw insertion from drooling

  • amateur censoredcreampiemarried womanmiummium-707mium707300mium-707
    • 2021-05-21
    60 min

    230OREC-765 Akane-san

  • amateur censoredcreampiebig titsorecorec-765orec765230orec-765
    • 2021-06-06
    41 min

    188HINT-0459 Reiko

  • amateur censoredmarried womansquirtinghinthint-0459hint0459188hint-0459
    • 2021-06-15
    89 min

    300NTK-588 Aim for the strongest Echikawa Gradle! !! A runaway is inevitable at the maximum erotic degree by putting an AV actor in the gravure photo session of a natural beautiful girl who is full of sexuality of the body that induces the lust of th

  • amateur censoredcreampieamateurntkntk-588ntk588300ntk-588
    • 2021-06-16
    126 min

    FC2PPV 1870280 Former child actor * Limited quantity * Early purchase recommended *

  • amateur uncensoredfc2
    • 2021-06-17
    58 min

    SIRO-4554 [First shot] [Before getting married ..] A slender hairdresser who is engaged with her boyfriend in the same year appears. Pleasure that can not be tasted by a boyfriend who has been dating for 10 years .. AV application on the net → AV exp

  • amateur censoredmarried womanamateursirosiro-4554siro4554siro-4554
    • 2021-06-20
    113 min

    [GENM-084]Big Titties Blissful SEX - Aggressive Man and Woman - Rui Miura

  • rui miura censoredbig titsblowjobGENMgenekigoldfish dGENM-084GENM084genm00084
    • 2021-06-23
    110 min

    428SUKE-076 [Transcendence squeezing tech → squeezing] MADOKA-chan ★ de M must-see! Queen of beautiful big breasts soft ass advent! Become a gold ball bread bread! !! The second round with a policewoman costume from a crisp vaginal cum shot! ？？ Being

  • madoka censoredcreampiebig titssukesuke-076suke076428suke-076
    • 2021-07-02
    167 min

    [DVDMS-686]Ordinary Couple Hidden Camera Footage AV Following A Teacher And S*****t After Fucking During A One-On-One Lesson Special College Girl Home Tutor With Big Tits Pops The Cherry Of Her S*****t With Gentle Cowgirl Riding! Without Pulling Out

  • censoredcreampiebig titsDVDMSdeep sDVDMS-686DVDMS686dvdms00686
    • 2021-07-09
    25 min

    FC2PPV 1911957 [Emergency 3 days only] (Leaked) Youth idol erotic leaked at a hotel on location [Caution to be deleted]

  • amateur uncensoredfc2
    • 2021-07-22
    193 min

    [MIFD-171]Fresh Faced College Girl, Fourth Year at a National University, Makes an Incredible AV Debut with Her Great Tits and Craving for Cock. Rino Yuki

  • yuki rino censoredbig titsbeautiful girlMIFDmoodyzmametaro mamezawamoodyz freshMIFD-171MIFD171mifd00171
    • 2021-07-29
    487 min

    [ABBA-529]The Hands Of Evil Had Penetrated Their Home ... And Are Grabbing Hold Of Her Meaty Ass! Fondle Those Big Tits! A Perp With A Pregnancy Fetish Is Targeting Meaty MILF Babes 30 Ladies 8 Hours 2-Disc Set

  • censoredcreampiemarried womanABBAcenter villageABBA-529ABBA529h-086abba00529
    • 2021-08-02
    134 min

    [AARM-003]They Get Whatever They Want With Their Dirty Tongue Techniques And Amazing Thigh Fucking Company President Natsuko Kayama And Vice-President Sara Ito"s Lewd Management Strategies

  • natsuko kayama ito sharan censoredmature womanAARMaroma kikakukadowaki shigeoaromaAARM-003AARM003aarm00003
    • 2021-08-12
    123 min

    [FSDSS-274]Home D***king Reverse Adultery, Friend"s Girlfriend Teases My Hard Cock And Nails Me In Cowgirl For Back To Back Cumshots. Arina Hashimoto

  • there is hashimoto censoredbeautiful girlslutFSDSSfalenonasty sanchezfaleno starFSDSS-274FSDSS2741fsdss00274
    • 2021-08-14
    46 min

    404DHT-0092 A Real Virgin Who Captures A Forty Mature Woman! Saya 41 Years Old

  • amateur censoredamateurmature womandhtdht-0092dht0092404dht-0092
    • 2021-08-21
    149 min

    [CEMD-048]First Anal! Aisha Yuzuki - Her Whole Thick And Curvy Body Gets Penetrated In Every Hole By Thick Objects Thrusting Away! Her Expanding Asshole Starts Making Lewd Noises!

  • yuzuki aisha censoredbig titsmature womanCEMDserebu no tomoCEMD-048CEMD048cemd00048
    • 2021-08-21
    140 min

    [APAK-198]Slutty And Lewd Real Masturbation Doll Mizuki Has A Seductive Facial Expression With Big Tits And A Huge Ass After A Masturbation Ban, We Have A Crazy Carnal Fucking Together Filmed Close Mizuki Yayoi

  • mizuki yayoi censoredbig titsslutAPAKaurora project annexrkAPAK-198APAK198apak00198
    • 2021-09-07
    52 min

    H0930 ki210907 Kumiko Moriwaki 33years old

  • amateur uncensoredh0930
    • 2021-09-17
    124 min

    [FOCS-019](Complete POV) Horny Girlfriend That Loves Dirty Talk While Squeezing All That Cum Out! This Innocent Looking Girl With A Kansai Accent Secretly Loves To Fuck! Nonstop Creampie With Tons Of Cum Overflowing From Her Pussy. Mikako Horiuchi

  • mikako horiuchi censoredcreampiesingle workFOCSabc mousou zokufocusFOCS-019FOCS019focs00019
    • 2021-09-24
    134 min

    [SKMJ-209]*Barely Legal *Absolute No Condoms *A 19-Year Old Exposes Her Lust And Goes On A Hot Spring Resort Vacation *A 4-Fuck Extravaganza

  • censoredcreampieamateurSKMJsekimenjoshikantori wajimasekimen goshiSKMJ-209SKMJ209h-1324skmj00209
    • 2021-09-29
    89 min

    348NTR-035 <Creampie To Fiance! > Discover A Sexy Sister In Front Of A Naughty Shop! !! The Man Who Feels The Difference In Age Next To Him Is Said To Have Been Engaged With His Boyfriend. He Puts Her On AV "Because I Don’t Work Very Wel

  • amateur censoredcreampiebig titsntrntr-035ntr035348ntr-035
    • 2021-10-08
    230 min

    [HUNTB-114]"I Love Big Bouncies!" Shota-kun"s Lewd Prank - Mina Kitano

  • censoredcreampieHUNTBhunterkonnyaku kannohhh groupHUNTB-114HUNTB114huntb00114
    • 2021-10-29
    143 min

    [BF-647]When I Saw MY Niece After 10 Years She Had Become An Erotic Gal And Drew Me Into Temptation! Pursued Me And Made Me Come With CowGirl Creampie. Runa Tsukino

  • tsukino luna censoredcreampieslutBFbefreeBF-647BF647bf00647
    • 2021-10-29
    161 min

    [MIFD-187]Slightly Boyish and Slightly Sensitive 19 Year-Old Downtown Exotic Chic Phillipina Mixed-Race Beautiful Girl AV Debut Ran Ayase

  • ran ayase censoredbeautiful girlsingle workMIFDmoodyztorendei yamaguchimoodyz freshMIFD-187MIFD187mifd00187
    • 2021-11-12
    120 min

    [PRED-353]Slutty Sex Friend Is Ruining Me. Sudden Blowjob And Swallow & Hammering Creampie Made Me Continue To Cum Multiple Times Until Morning. Yuki Takeuchi

  • yuki takeuchi censoredcreampieblowjobPREDpremiumakai suiseielegancePRED-353PRED353pred00353
    • 2021-11-17
    85 min

    435MFC-159 [Raw Saddle Sex Treatment Friends @ Big Breasts Shaved College Student] Glamorous Body Muchimuchi JD Saffle And Gonzo Sex From Midday ♪ I Can’t Stop Seriously With Sex Toys And I Haven’t Waited For Reason Collapse! !! !! Thick Va

  • amateur censoredcreampiebig titsmfcmfc-159mfc159435mfc-159
    • 2021-11-19
    161 min

    [CJOD-320]I"m The Homeroom Teacher, And One Day, After School, I Was Taken To A Love Hotel By Three Of My Slut S*****ts, Who Surrounded Me, Jammed Me In, And Compelled Me To Creampie Them. Lala Kudo Urara Kanon Ichika Nagano

  • lara kudo hanaoto urara censoredcreampieuniformCJODbisapporo tarouchijo hebunCJOD-320CJOD320cjod00320
    • 2021-11-27
    67 min

    300NTK-665 [Neat And Clean Dobitch Girl] [Moe Jargon Attack Uniform Convulsions Nn2] [Hidden Jargon ● Boyne Discovered! !! ] People Do Not Look Like! !! Such A Neat And Orthodox Beautiful Girl Is A Nasty And Beautiful Busty Hidden Boyne-Chan …!

  • pinnn censoredcreampieuniformntkntk-665ntk665300ntk-665
    • 2021-12-03
    114 min

    [ADN-358]Ravaged In Front of Husband - Reunion Is The Start Of Doom!!! Reira Kuon

  • leira haduki censoredsingle workdramaADNattackerskazumaotona no dramaADN-358ADN358adn00358
    • 2021-12-04
    60 min

    H4610 ki211205 Aoi Katayama 26years old

  • amateur uncensoredh4610
    • 2021-12-10
    92 min

    ZOCT-042 Mikako (Mikako Horiuchi)

  • amateur censoredcreampieamateurzoctzoct-042zoct042zoct-042
    • 2021-12-10
    139 min

    [YMDS-066]Cuddling and D***king at Home, French Kissing and Having Sex Closely, The Day Yu Hironaka Became my Girlfriend

  • yu hironaka censoredcreampieblowjobYMDSmomotarou eizou shuppanjaku momoYMDS-066YMDS066ymds00066
    • 2021-12-17
    120 min

    [PRED-364]The Coexistence Of Intelligence And Loving Dicks. My Older Stepsister Has A Weakness For Dicks Despite Her Stuck-Up-Looking Face. An Adult Video Debut. Ryou Tsubaki

  • ryo tsubaki censoredcreampieblowjobPREDpremiumelegancePRED-364PRED364pred00364
    • 2021-12-19
    58 min

    [HEYZO-2680]Keiko Udaka Defiling A Masochist Pervert Girl"s Body!

  • keiko udaka uncensoredcreampieblowjobheyzo
    • 2022-01-07
    119 min

    [JUL-829]A Beautiful Married Woman Who Is Drowning In Pleasure At A Remote, Mixed Bathing Hot Spring In The Middle Of Nowhere. Minase Amakawa

  • minase tianhe censoredcreampiemature womanJULmadonnamametaro mamezawaJUL-829JUL829jul00829
    • 2022-01-14
    153 min

    [MIAA-562]If You Have Money, You Can Do It! Girls With Big Tits Buying Large Amounts Of Creampie. Kokona Asakura. Kasumi Tsukino.

  • kasumi tsukino asakura here censoredcreampiebig titsMIAAmoodyzryo gokuminna no kikatanMIAA-562MIAA562miaa00562
    • 2022-01-15
    241 min

    [OVG-190]Female Body Fetish Encyclopedia 4 - Complete, Fully Naked 66 People

  • censoredbig titsOVGglory questOVG-190OVG190ovg00190
    • 2022-01-19
    60 min

    324SRTD-0272 Compliant Big Tits Esthetician Picking Up Girls Creampie

  • amateur censoredcreampiebig titssrtdsrtd-0272srtd0272324srtd-0272
    • 2022-01-25
    77 min

    326EVA-168 Big Breasts Ranbu! !! The I-Cup Female College Student I Met On The Slopes Is … The Best Lewd Body This Winter! !! (Yuri Oshikawa)

  • amateur censoredbig titsamateurevaeva-168eva168326eva-168



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored