cheating wife def creampie big tits married woman




FC2HUNTBBLKNGODDASDPPPDCAWDHNDAWDFSDSSAVSACHRVADNATIDSPRDSHKDNACXAUKGPREDVEMAAMBI

2020-09-20
97 min

300MAAN-582 [Magic beauty body x 3 vaginal cum shot] DM attack on erotic Kawa JD that uploads naughty videos to T ☆ k Tok! !! If you meet, you will encounter an unequaled bitch with bottomless libido! !! Rich tongue licking blowjob with erotic costum

  • amateur censoredcreampieamateurmaanmaan-582maan582300maan-582
    • 2020-10-01
    61 min

    [SIROR-030]MILF For Hire -The Hidden Side Of A Mature Woman Her Husband Never Sees File No. 30 -

  • censoredcreampiebig titsSIRORamateur dispatch.comSIROR-030SIROR030h-1492siror00030
    • 2020-10-17
    53 min

    300NTK-449 5 shots in the vagina continuously! !! Sperm dog SEX of a mysterious glamorous beauty with a bust of 100 cm tall! !! Does she think of Nani at the end of her unstoppable libido …! ？？ The tight-fitting squeezing maco is just a vise! !!

  • amateur censoredcreampiebig titsntkntk-449ntk449300ntk-449
    • 2020-10-31
    118 min

    [MIAA-336]I Pimped My Sweet Busty Classmate Out To Older Guys For Unlimited Creampies. Tomoko Kamisaka

  • tomoko kamisaka censoredcreampiebig titsMIAAmoodyzhiroaminna no kikatanMIAA-336MIAA336miaa00336
    • 2020-11-07
    118 min

    [VEO-035]A Real Amateur Wife Makes Her Adult Video Debut!! This Natural Airhead H-Cup Titty Beautiful Big Tits Caregiver Wife Is So Nice, It Makes Her Think Twice Sayuri Mitsumoto

  • sayuri mitsumoto censoredcreampiebig titsVEOvenusbingo tamatsukabornVEO-035VEO035veo00035
    • 2020-11-07
    149 min

    [FLAV-255]HYPER FETISH Long-Legged Nasty Queen Emma Kuriyama

  • eri kuriyama censoredslutsingle workFLAVdigital arkdigital ark digital arkFLAV-255FLAV255flav00255
    • 2020-11-08
    65 min

    [orex-169]みつき 5

  • amateur censoredcreampieamateurorexorex-169orex169orex-169
    • 2020-11-27
    123 min

    [CRDD-005]Teens Only, Raw Creampie Western Back Street Pick Ups 004

  • censoredcreampiebig titsCRDDcrazy walkermanjiroCRDD-005CRDD005h-1518crdd00005
    • 2020-12-08
    80 min

    200GANA-2400 Seriously Nampa, first shot. 1565 Feeling like a floating lady! A love interview with a neat female college student! The bottom story sticks into the absurd body, and the heart that gradually unravels … If you notice it, you will be

  • amateur censoredamateurganagana-2400gana2400200gana-2400
    • 2020-12-12
    112 min

    390JAC-075 [G huge breasts cheer girl x 5 vaginal cum shot] Pai slash! !! Big breasts RUSH on the verge of explosion! G huge breasts that shake swaying Japan! Good to touch! Good to see! It’s okay to massage! Don’t miss the strongest rampag

  • amateur censoredcreampiebig titsjacjac-075jac075390jac-075
    • 2020-12-31
    88 min

    [ADN-284]How To Seduce A Lonely Married Woman Hijiri Maihara

  • kiyoshi maihara censoredsingle workADNattackerssayaka dateotona no dramaADN-284ADN284adn00284
    • 2021-01-08
    241 min

    [HEZ-243]Guaranteed Satisfaction! We Seduced An Amateur Girl And Seriously Sweet-Talked Her! Best Edition 14 Girls

  • censoredbig titsamateurHEZhot entertainmentnetsuyujinHEZ-243HEZ24359hez00243
    • 2021-01-09
    151 min

    [MIDE-874]Tsubomi Detonation She'll Revive Those True Perverted Feelings Through Drool, Pussy Juice, And Cum, All Dripping And Leaking And Cumming Like Crazy! A Passion-Baring Fuck Fest That Bursts Past All Limits

  • bud censoreddeepthroatsingle workMIDEmoodyzmichiru arashiyamamoodyz divaMIDE-874MIDE874mide00874
    • 2021-01-15
    119 min

    [XRW-962]Flirty Undercover Investigation 10

  • censoredbig titsXRWreal workstomimasu diranreal real worksXRW-962XRW962172xrw00962
    • 2021-01-16
    104 min

    390JAC-074 [Shake G milk GAL x 4 vaginal cum shot] G splash! !! G milk and tide festival begins! Creampie large board behavior! Saddle tide large board behavior! Revolutionary large amount of 711ml sperm that loops 1G cum shot! The strongest masterpi

  • ggal censoredcreampiebig titsjacjac-074jac074390jac-074
    • 2021-01-20
    480 min

    [EIH-057]Amateur Office Lady Private SEX: 8 Hours

  • censoredcreampieamateurEIHstar paradiseeight hEIH-057EIH057h-254eih00057
    • 2021-01-31
    69 min

    300NTK-511 Ramen shop GAL that is too beautiful! !! Taste both men and chin! !! Ferateku has a sizzle feeling! ？？ Beautiful big breasts with pink nipples are breasts that can be lined up! !! The finest gal who wants to bend her beautiful body with ca

  • amateur censoredcreampiebig titsntkntk-511ntk511300ntk-511
    • 2021-02-06
    120 min

    [JUL-461]Married Office Girl's Sexy Thighs - Totally Dominated By Her Boss, This Chaste Wife Becomes His Obedient Cum Dumpster. Nao Jinguji

  • jinguji temple nao censoredbig titsmature womanJULmadonnajotaro tomiJUL-461JUL461jul00461
    • 2021-02-10
    71 min

    SWEET-050 Rinori

  • amateur censoredschoolgirlamateursweetsweet-050sweet050sweet-050
    • 2021-02-19
    37 min

    FC2PPV 1693403 Weekend only [Individual shooting] Prefectural general course ② Curious black-haired girl. She is Gonzo by a cram school teacher.

  • amateur uncensoredfc2
    • 2021-02-22
    64 min

    FC2PPV 1696568 [Amateur] Miraculous child’s first shooting AV debut [February limited sale]

  • amateur uncensoredfc2
    • 2021-02-25
    108 min

    300MIUM-677 [Cute face and demon de M] [Chi ● Ko strangling while being thrust, trampling favorite] [Glossy milk and plump ass that you want to suck] The beautiful girl with an idol face has a cute face and M! Switch on with nipples! !! Unstoppable l

  • amateur censoredcreampieamateurmiummium-677mium677300mium-677
    • 2021-03-05
    74 min

    [LVID-010]Everyday Life Of A Sexy And Horny Step Daughter / Shizu-chan

  • censoredLVIDorustak softloveidolLVID-010LVID010
    • 2021-03-13
    120 min

    [IPX-627]My Beloved Fiance`s Older Brother Is The Stalker Who Used To Fuck Me Karen Kaede

  • karen kaede censoreddramaIPXidea pocketdragon nishikawatissueIPX-627IPX627ipx00627
    • 2021-03-18
    50 min

    H0930 ki210318 Kozue Soma 42years old

  • amateur uncensoredh0930
    • 2021-04-10
    54 min

    H0930 tk0032 Miria Kifuji 30years old

  • amateur uncensoredh0930
    • 2021-04-15
    136 min

    [MKON-050]The Story Of How The Girl I Was In Love With Forever Was Stolen By Another Man Right After We Started Dating Chiharu Sakurai

  • chiharu sakurai censoredcreampieuniformMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-050MKON050mkon00050
    • 2021-04-16
    68 min

    FC2PPV 1772937 * Weekend limited 6000⇒3980pt ★ First shot premiere ☆ Until recently, I was a virgin! Moe-chan, an active JD who can play youth, 18 years old ☆ Enjoy the undeveloped BODY ♥ Good at handjob blowjob ♥ Creampie with excitement ♥ [Individu

  • amateur uncensoredfc2
    • 2021-05-02
    131 min

    [SOAN-057]An Intellectual Anal Surface Inspection A 2-Hole Specialized Maso Cum Bucket Who Has Achieved A State Of Repeated Sensual Orgasmic State Through Her Sigmoid Colon Residence: Akiruno Occupation: Forestry Age: 28 Reason For Switching Jobs: Sh

  • haruka censoredsingle workSOANyama to soramaketaro tanizokoanal visitSOAN-057SOAN057soan00057
    • 2021-05-20
    120 min

    [ARSO-21146]My Wife -Celeb Club- 146

  • masaru momose miu nonomura censoredblowjobARSOaroundARSO-21146ARSO21146h-1378arso21146
    • 2021-06-05
    120 min

    [ANB-189]I Became My Mother-in-law's Sex Toy: Thick Fucking With A Hot Mother-in-law! Yuri Tadokoro

  • yuri tadokoro censoredmature womanslutANBrubysusumu yanokuchinobleANB-189ANB189anb00189
    • 2021-06-11
    150 min

    [IPX-669]I Can No Longer Live Without Sex ... 286 Climactic Orgasms 3045 Vaginal Spasms 2781 Demonic Piston-Pumping Thrusts Squirts Of Pleasure: Immeasurable An Orgasmic Awakening Iyona Fujii

  • iyo fujii censoredsquirtingsingle workIPXidea pocketdragon nishikawadishIPX-669IPX669ipx00669
    • 2021-06-12
    132 min

    [SABA-703]Sharing A Hotel Room With My Coworker After We Went Out And Missed The Last Train... She Seemed So Unguarded, I Couldn't Resist Her... vol. 009

  • censoredcreampieuniformSABAskyu shirototodoSABA-703SABA703saba00703
    • 2021-06-15
    59 min

    Caribbeancom 061521-001 She loves to have sex with a shorter man Rin Hashimoto

  • rin hashimoto uncensoredcreampiehandjobcaribbeancom
    • 2021-07-06
    85 min

    FC2PPV 1907983 A boxed girl living in Minato Ward. She has a frustrated body that can’t forget sex. The aching pussy can not be suppressed … Libido is released to a dedicated ejaculation toy with an unequaled cock.

  • amateur uncensoredfc2
    • 2021-07-06
    80 min

    469G-647 Imadoki Girls’ Yen Exchange (Daddy Activity) Circumstances! Cherry Blossoms

  • amateur censoredcreampiebig titsgg-647g647469g-647
    • 2021-07-21
    92 min

    420SWEET-061 Maa

  • amateur censoredbig titsuniformsweetsweet-061sweet061sweet-061
    • 2021-07-24
    240 min

    [SGSR-282]Amateurs On Street Corners The Mature Woman Channel They're In Their Forties And Fifties, But Check Out These Big Tits! This Is Indeed The Erotic Discovery Of A True Sexual Genius! These Jiggling And Wiggling Nipples And Hard Nip Nops A

  • censoredbig titsamateurSGSRbig mocalprosperitynew battle groupSGSR-282SGSR28257sgsr00282
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-15
    135 min

    [OVG-182]Do You Like Blowjobs From My Older Stepsister, Who Loves Dicks？

  • kana morisawa kanako iioka natsu tojo censoredblowjobslutOVGglory questOVG-182OVG182ovg00182
    • 2021-09-24
    128 min

    [NAD-004]This Gal Is In Charge Of My Nipples - Ranka

  • ranka censoredcreampiesquirtingNADdream ticketmatsukata piromuNAD-004NAD00424nad00004
    • 2021-10-22
    54 min

    FC2PPV 2364567 [New Work, Half Price! ] ♀ 250 Reading More ◯ -Chan 18 Years Old 11th Time A Beautiful Girl Of The Active J Generation Is Contraceptive With A Dirty Race Queen Costume And Conceived In A Contraceptive Ma ◯ Co And Cum Shot Seeding Raw S

  • amateur uncensoredfc2
    • 2021-11-06
    69 min

    H0930 ki211107 Yuri Nonoda 30years old

  • amateur uncensoredh0930
    • 2021-11-12
    115 min

    [BLK-536]Behaved Like Gentleman When Picking Up Runaway Gal And She Liked Me And Came With Me. Rampant Sex In Single Room Used For Teleworking.

  • censoredblowjobbeautiful girlBLKkira kirakira hosi kira black galBLK-536BLK536blk00536
    • 2021-11-13
    122 min

    [GVH-322]The Son-in-Law Goes After the Overly Obscene Big Tits of His Mother-in-Law. Rio Ohara

  • osamu osamu censoredcreampiebig titsGVHglory questtakahashi chitsujiGVH-322GVH322gvh00322
    • 2021-12-10
    176 min

    [SSIS-259]Result of Rushing, Hurrying, Panicking. Misaki Haraki"s Spirit Is Crushed And She Is Dying For Dick And Lewd SEX.

  • miharu hanasaki censoredbig titsbeautiful girlSSISs1 no 1 styletake dSSIS-259SSIS259ssis00259
    • 2021-12-15
    45 min

    [121521-001][VR] Sex Appeal Lady : Vaginal Cum Shots with Licking Technics

  • ciel hiiragi uncensoredcreampiecaribbeancom
    • 2021-12-16
    57 min

    H4610 ki211216 Nanako Shirai 20years old

  • amateur uncensoredh4610
    • 2021-12-23
    120 min

    [DLDSS-040]"Take It Off And Apologize." Erect And Devour A Man. An Obscene Demand From A Beautiful Lascivious Kramer. Suzume Mino

  • suzume mino censoredbig titsslutDLDSSdahliayaru yoshi 3DLDSS-040DLDSS0401dldss00040
    • 2021-12-30
    62 min

    FC2PPV 2552415 [The Latest Work Is Also On Sale At Half Price] 3500pt → 1750pt [Appearance] [No Mo] [Serious Girl] First Gonzo ♥ Black Superficial Slender Amateur Girl ♥ Excited By The Gap With A Too Nasty Appearance Massive Creampie ♥

  • amateur uncensoredfc2
    • 2022-01-08
    51 min

    519MAZOF-032 [Nude That A Man Becomes Stupid] Famous School Big Breasts I Cup Art Teacher 28 Years Old The World’s Best Busty Teacher Dohamari For The First Gonzo, Ascending To The White Eyes With Unstoppable Convulsions Acme Real Masochist Fema

  • amateur censoredcreampiebig titsmazofmazof-032mazof032519mazof-032
    • 2022-01-27
    120 min

    [FANH-062]Hikari, A Frustrated Married Woman With A Good Floor A Woman Who Has Been Cheating On Her Husband For A Long Time I"m Going To Have An Affair With A Woman.

  • censoredcreampiebig titsFANHhamedori.network secondeditionFANH-062FANH062h-1472fanh00062
    • 2022-01-28
    67 min

    FC2PPV 2629209 [No] The “Signboard Girl” Of The Favorite Izakaya ♥ Date And Bed In With Tipsy Each Other. The Meat Stick Reacts Violently To The Gap With Usual! A Large Amount Of Vaginal Cum Shot With A Young Slender Body! !!

  • amateur uncensoredfc2
    • 2022-01-29
    159 min

    [BAB-052]Instant Blowjob And Creampie. 4 Cum Loads. Ranka.

  • ranka censoredcreampiebig titsBABbabylon mousozokuBAB-052BAB052bab00052
    • 2022-02-03
    82 min

    534IND-037 Pregnancy Inevitable 2 Consecutive Creampies For Roriman Who Looks Innocent Appearance _ Childhood Remains

  • amateur censoredcreampieamateurindind-037ind037534ind-037
    • 2022-02-10
    294 min

    [SVDVD-905]One-Way Mirror Car: Hard Boiled - If You"re Willing To Try Our Cutting-Edge Anal Reflexology, You"ll Win 10 Grand! We Asked Hot MILFs On Their Way To A Massage Parlor Then Went Straight For Their Ass! They"d Never Experienced A

  • censoredcreampiemarried womanSVDVDsadistic villagenew kazi kazamamagic mirror sadistic villageSVDVD-905SVDVD9051svdvd00905



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored