chijo heaven




FC2SDABSANEBODMEYDDASDSSISHNDMILKCESDSQTENATRMVSDNGODVEMAJUFESSNIMIDVVENXSHKDAUKG

2020-12-12
182 min

[MIFD-139]A Fresh Face 19 Years Old An H-Cup Big Tits College Girl In Glasses Makes Her Adult Video Debut - She Looks Like Her Guard Is Strong, With Her Glasses In Place, But Her Titties Are Unprotected - Nenne Ui

  • first love censoredbig titsbeautiful girlMIFDmoodyzusa pyonmoodyz freshMIFD-139MIFD139mifd00139
    • 2020-12-14
    25 min

    FC2PPV 1606407 Limited to 300 pieces [Individual shooting] Prefectural general course ③ Karate beautiful girl. First time 〇

  • amateur uncensoredfc2
    • 2020-12-18
    212 min

    [GZAP-037]Honor S*****t Is A Secret Exhibitionist "What'll I Do If Somebody Finds Out I Get Naked After School？!" I Saw All The Dirty Details, Beginning To End... vol. 3

  • censoredGZAPprestigezapGZAP-037GZAP037118gzap00037
    • 2020-12-18
    73 min

    415LAS-033 Ayakan (Ayaka Mochizuki)

  • amateur censoredcreampiebig titslaslas-033las033415las-033
    • 2020-12-21
    153 min

    [FCDC-125]This Alluring Secretary Has Erect Nipples And A Small Waist And Likes To Lure The Employees To Temptation Because, After All, She's A Horny Slut Hotaru Mori

  • hotaru mori censoredslutsingle workFCDCweekenderFCDC-125FCDC125fcdc00125
    • 2020-12-26
    67 min

    FC2PPV 1621614 ★ First shot amateur ☆ Neat and clean Alice from Spain 19 years old ☆ Super erotic girl who changes suddenly ♥ Super iki with white eyes peeled ♥ On the verge of outburst on a small devil blowjob ♥ First vaginal cum shot of apt ♥ [Pers

  • amateur uncensoredfc2
    • 2021-01-01
    139 min

    [PKPD-127]Sleepovers With Girl Nerds Caught On Camera - One Night Of Raw Sex With Innocent Anime-Loving Goddess Tsumugi Narita - Feel Like Her Boyfriend Tsumugi Narita

  • narita tsumugi censoredcreampiebeautiful girlPKPDfuck group and fun friends daydreamersPKPD-127PKPD127pkpd00127
    • 2021-01-01
    142 min

    [KTB-038]For Use At The Office - Seducing 26-Year-Old Married Office Worker Kanade - Bukkake! The Office Girls In Suits Club 17 Kanade Tsuchiya

  • kana tsuchiya censoredcreampiesingle workKTBkahanshin tigers mousouzokukahanshin tigersKTB-038KTB038ktb00038
    • 2021-01-10
    328 min

    [NSPS-960]The Cuckold: Jealousy Fans The Flames Of Passionate Cheating Sex - Best Edition

  • yuri sasahara miki hayashi censoredmature womandramaNSPSnagae stylejotaro tomiNSPS-960NSPS960nsps00960
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-23
    59 min

    SIRO-4399 [First shot] [Signboard girl of a set meal shop] [Healthy naked body trembling jerky] A shy reaction that raises lust. If a simple girl with a serious personality also falls into pleasure .. AV application on the net → AV experience shootin

  • amateur censoredamateursirosiro-4399siro4399siro-4399
    • 2021-01-30
    64 min

    SIRO-4411 [First shot] [Supreme style] [Sensitive premature ejaculation ○ ko] A perfect beauty salesperson with the best face, body, and sensitivity. If you grab Yanagi’s waist and pierce the big cock, you will bounce your waist many times and r

  • amateur censoredbig titsamateursirosiro-4411siro4411siro-4411
    • 2021-02-03
    52 min

    FC2PPV 1671151 In search of pleasure] Married woman picking a hole for her husband with a stick] Insta wife 23 years old Orgasm is good for beauty! And the wife who came to the adult toy test. Reason collapse in front of a big cock “It reaches t

  • amateur uncensoredfc2
    • 2021-02-12
    148 min

    [IPX-618]It's Not Cheating If You Only Use Your Mouth, Right？ Lies Aren't The Only Things Women's Mouths Are Good For... Cheating Blowjob Infidelity Feature Tsumugi Akari

  • akari tsumugi censoredcreampieblowjobIPXidea pocketdishIPX-618IPX618ipx00618
    • 2021-02-15
    49 min

    FC2PPV 1687864 [First time limited 1980] That natural beauty big breasts G cup ❤️ The size of the boobs has increased ❤️ H cup fair body ❤️ A large amount of vaginal cum shot again in a very narrow pussy ❤️ * Review privilege “Squirting challeng

  • amateur uncensoredfc2
    • 2021-02-17
    13 min

    S-Cute 817_mone_02 I took a picture of her blowjob in the bathroom / Mone

  • mone censoredamateurmonemone-02mone02817-mone-02
    • 2021-02-20
    55 min

    Caribbeancom 022021-001 Soapland With Young Girl Only, 10 Minori Koike

  • minori koike uncensoredcreampiehandjobcaribbeancom
    • 2021-02-25
    73 min

    FC2PPV 1701084 [No appearance] Unauthorized raw vaginal cum shot to a super rare slender beauty Shrimp warp NTR [Personal shooting] Continuously alive with a generalized erogenous zone and seeding sanctions on a nasty pussy cheating just before marri

  • amateur uncensoredfc2
    • 2021-03-01
    67 min

    488MCV-010 The case that I was crazy about girls with literary glasses

  • amateur censoredamateurbeautiful girlmcvmcv-010mcv010488mcv-010
    • 2021-03-04
    62 min

    [KBTV-068]A Married Woman Shows A Side Of Herself That Her Husband Never Gets To See Misako-san

  • censoredcreampiebig titsKBTVfirst av appearanceKBTV-068KBTV068h-244kbtv00068
    • 2021-03-11
    121 min

    [FSDSS-182]Cumming So Hard It Feels Like The World Is Ending - Mayoi Arisaka

  • arisaka mayoi censoredbig titssquirtingFSDSSfalenotonkatsufaleno starFSDSS-182FSDSS1821fsdss00182
    • 2021-03-12
    70 min

    FC2PPV 1723045 051 [Massive facial cumshots on a beautiful wife] There is only one thing to do for a married woman to make small changes

  • amateur uncensoredfc2
    • 2021-03-19
    60 min

    [sika-051]まどかちゃん(18)

  • amateur censoredcreampiesquirtingsikasika-051sika051sika-051
    • 2021-04-06
    79 min

    261ARA-479 [Enchanted God Body] 23 years old [Greedy Beauty] Saeko-chan is here! The reason for her application, which is quite aesthetically pleasing, is "I want to have sex and be beautiful ♪" As a result of pursuing beauty, the approach fr

  • amateur censoredbig titsamateuraraara-479ara479261ara-479
    • 2021-04-08
    146 min

    [HAWA-243]Real-Life Sub Ballet Teacher's Nimble Body Tied Up By A Hung Older Man With A BDSM Fetish - Her Supple Flesh Pumped Full Of Cum And Made To Orgasm Yuki, Age 28

  • censoredmarried womanamateurHAWAcosmos videohide monkcosmospictures soft on demandHAWA-243HAWA2431hawa00243
    • 2021-04-08
    158 min

    [NHDTB-515]2 Holes, Simultaneous Finger Insertion Acme Touching 3

  • censoredsquirtingNHDTBnatural highjacken kodamaNHDTB-515NHDTB5151nhdtb00515
    • 2021-04-10
    131 min

    [KYMI-012]Self Shots: Fucked With Dirty Talk - Clothed Slut

  • tsukasa nagano minami saya censoredslutKYMImiluaida yumenoKYMI-012KYMI012kymi00012
    • 2021-04-17
    119 min

    [CAWD-210]While My Girlfriend Was Away On An Employee Seminar, I Met Up With My First Love, Whom I Could Never Forget, And We Had Mind-Blowing, Crazy Sex For 3 Days Straight Hana Shirato

  • white peach censoredcreampiebeautiful girlCAWDkawaiikyoseiCAWD-210CAWD210cawd00210
    • 2021-04-18
    164 min

    [FCDC-131]We Pulled The Panties Off Of The Hotly Rumored New Employee With A Great Big Ass And Got Her Nipples Rock Hard And Ready And Then She Transformed Into A Perverted Erotic Horny Maso Slut Bitch

  • censoredbukkakeFCDCweekenderFCDC-131FCDC131fcdc00131
    • 2021-04-21
    93 min

    300MAAN-646 [Mutty nursery teacher / Naked apron / Don Pisha hugging body] Blow job, fucking, breastfeeding handjob … Premature ejaculation & decachin men’s worries solved with gentleness full of maternity of occupational pattern and dir

  • amateur censoredcreampiesquirtingmaanmaan-646maan646300maan-646
    • 2021-05-01
    148 min

    [GOJU-178]Begging To Deep Throat That Huge Cock She's Always Dreamed Of! Beautiful Older Woman Orgasms From Both Her Mouth And Pussy

  • censoredsquirtingamateurGOJUfifty somethingGOJU-178GOJU178h-1165goju00178
    • 2021-05-05
    39 min

    279UTSU-509 Amamiya-san

  • amateur censoredcreampiemarried womanutsuutsu-509utsu509279utsu-509
    • 2021-05-08
    157 min

    [MDBK-177]A Complete POV Little Stepsister Style Maid Delivery Health Call Girl Service Cums With A Shaved Pussy Creampie Option 4

  • ichika matsumoto chiharu miyazawa censoredcreampiecosplayMDBKbazookaMDBK-177MDBK177mdbk00177
    • 2021-05-28
    141 min

    [MMND-198]"I Could Never Appear In An Adult Video" Rian Aoi Colossal Tits x A Massive Ass A Horny And Obedient Flesh Fantasy Pet An H-Cup Voluptuous College Girl Will Provide You With All The Fucking You Could Ever Want!

  • rian aoi censoredbig titssingle workMMNDmimanyuki iwasawaMMND-198MMND198mmnd00198
    • 2021-06-10
    121 min

    [FSDSS-240]A Nurse's Mistake! Shaved Pussy Beauty Cum In Mouth Mania Meisa Kawakita

  • kawakita meisa censoredblowjobbeautiful girlFSDSSfalenokei isoifaleno starFSDSS-240FSDSS2401fsdss00240
    • 2021-06-17
    148 min

    [LZDQ-023]Former Local TV Station Female Newscaster & Young Idol Collaboration First Time Lesbians Number Of Orgasms Challenge

  • narita tsumugi elena takeda censoredlesbianbeautiful girlLZDQlesreheavy smoky ishiirezure documentLZDQ-023LZDQ023lzdq00023
    • 2021-06-30
    135 min

    [GVH-257]Anal Ballerina 6 - Erena Takeda

  • elena takeda censoredanalsingle workGVHglory questchintaGVH-257GVH25713gvh00257
    • 2021-07-08
    226 min

    [NHDTB-552]You're At A Men's Massage Parlor Where You're Not Allowed To Touch This Beautiful Therapist, But She Seems So Touchable And Yet Unattainable, So You Pumped Her Full Of Aphrodisiacs And Now She's Bending Over Backwards In Ec

  • censoredsquirtingNHDTBnatural highkansukeNHDTB-552NHDTB5521nhdtb00552
    • 2021-08-02
    126 min

    FC2PPV 1952142 3Q Legend ♥ ️ A Few Years After The Shocking Virginity Loss Video … A Transparent Fair-Skinned Slender Beautiful Nude ♥ ️ Innocent Beauty Pussy With A Hymen Still ♥ ️ Urgent Release Of An Unreleased New Motion Picture Left By That

  • amateur uncensoredfc2
    • 2021-08-07
    119 min

    [BAHP-084]Black-Market Porn - Posting From A Burner Account - Popular 20-Year-Old College Girl Caught On Camera Offering To Do Nudes And POV For Cash. Rina Uchida

  • rina uchida censoredslutsingle workBAHPbarutanyoshida daibutsuhoppinBAHP-084BAHP084bahp00084
    • 2021-08-12
    161 min

    [HAWA-256]A Kindly Amateur Housewife Will Lovingly D***k Our Cum, And She Loves It More Than Her Husband The 4th Best Little Sister Grand-Prix Cum D***king Party, Loving And Laid Back Kindergarten Teacher Takes 18 Shots With A Smile, Nanami-san (26 Y

  • censoredamateurHAWAkosumosu eizouhide monkcosmospictures soft on demandHAWA-256HAWA2561hawa00256
    • 2021-09-08
    106 min

    428SUKE-087 [Chest / Butt / Sensitivity ← Gold Medal Class! ？？ ] Borrow A Mobile Battery And Samurai Girls And Pakopako Sp! !! Are You Aiming For Nani’s Gold Medal Four Years Later？ Cowgirl？ !! Belotech？ !! I Love Flirting! !! With Quick Charge

  • amateur censoredcreampiebig titssukesuke-087suke087428suke-087
    • 2021-09-17
    120 min

    [MEYD-704]My Friend"s Big Tits MILF Mama Is Infiltrating My Eardrums With Dirty Talk And Sneakily Luring Me To Creampie Temptation JULIA

  • julia censoredbig titsslutMEYDtameike gorok westMEYD-704MEYD704meyd00704
    • 2021-10-15
    105 min

    [VEC-499]A Secret Between Me And My Friend"s Mother. Forcibly Had Creampie Sex With Her... Miyu Tsubakihara

  • miyu tsubakihara censoredcreampiemature womanVECvenussarumegami venusVEC-499VEC499vec00499
    • 2021-10-16
    143 min

    [GMEM-046]A Big Titty Maso Tanned Gal Got Installed With Perversion And She Re-Awakened As A Sex Doll Runa Shimotsuki

  • shimotsuki runa censoredsingle workGMEMavsbuddha davscollector s goldGMEM-046GMEM046gmem00046
    • 2021-10-27
    39 min

    FC2PPV 2374790 First Shot! !! Limited Number! [Uncensored] "I Can’t Do Anything With My Classmates …" A Beautiful Girl With Twin Tails Is Forced To Obscene In The Park Next To Outdoor Obscenity! !! Bring It To A Closed Room And Make

  • amateur uncensoredfc2
    • 2021-11-04
    110 min

    [STSK-004]Peeping on People Next Door Two People 23 School Visits/Rooms 8 Days

  • censoreduniformamateurSTSKshirouto 39STSK-004STSK004h-1605stsk00004
    • 2021-11-05
    122 min

    [UMD-802]A Married Woman Parties Hard 4 While Her Husband Was Away, This Wife Will Play ... When A Married Woman Gets Busy, She"ll Cum Like Crazy.

  • kiyoshi maihara suzuki mayu censoredbig titshandjobUMDleodoragon nishikawaUMD-802UMD802125umd00802
    • 2021-11-13
    122 min

    [GVH-322]The Son-in-Law Goes After the Overly Obscene Big Tits of His Mother-in-Law. Rio Ohara

  • osamu osamu censoredcreampiebig titsGVHglory questtakahashi chitsujiGVH-322GVH322gvh00322
    • 2021-11-13
    46 min

    H4610 ori1768 Natsuki iguchi 20years old

  • amateur uncensoredh4610
    • 2021-12-10
    107 min

    [VENX-098]"Do My Panties Turn You On？" Aunt Who Squeezed Last Drop of Nephew-In-Law"s Sperm WIth Half Removed Panties. Akari Neo

  • akari neo censoredcreampiemature womanVENXvenusmajime kitanofakecest winntersVENX-098VENX098venx00098
    • 2021-12-14
    49 min

    498DDH-053 [I Found Out That The Men’s Beauty Salon I Visited For The First Time Has A Good Reputation. A Unique Service That The Beautiful Staff Puts The Body In Close Contact With The Treatment! ] This Is Normal, Isn’t It？ Big Ass, Tall O

  • amateur censoredcreampiebig titsddhddh-053ddh053498ddh-053
    • 2021-12-27
    66 min

    481SACZ-103 Fumiko Miyake / Nagisa

  • amateur censoredmarried womanamateursaczsacz-103sacz103481sacz-103
    • 2022-01-14
    236 min

    [SKMJ-244]未成年素人 生まれて初めての恥じらい素股体験！クリトリスが勃起チ○ポと擦れ合って我慢できずにヌルっと生挿入！そのまま10代うぶオマ○コに生中出し！

  • censoredcreampiebeautiful girlSKMJred face girlone topSKMJ-244SKMJ244h-1324skmj00244
    • 2022-01-24
    33 min

    FC2PPV 2618852 [Personal Shooting / Creampie] A 33-Year-Old Mature Wife Who Knows The Taste Of Ji Po Other Than Her Husband And Is Addicted To It "I Knew The Real Pleasure …"

  • amateur uncensoredfc2
    • 2022-01-28
    42 min

    FC2PPV 2629478 [Raw Off-Paco] [Sef Recruitment] [Support] Gonzo With A Natural Ass Light Girl Who Likes Uncle! Look At The Talent Of Amateurs! Wet A Naive Pussy In Uniform And Sprinkle With A Cock !!

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored