compilation creampie def censored over hours




FC2CAWDFSDSSPPPDWAAAHNDMILKSTARSSHKDVENXAVSARBDKSBJEBODJUFEABWSSISAUKGJULHUNTBHDKA

2020-09-18
103 min

[DDK-200]Fallen Woman Who Has It Stuck In All Her Holes - Natsuki Kisaragi

  • natsuki kisaragi censoredcreampiedeepthroatDDKdogmanormal kimDDK-200DDK200ddk00200
    • 2020-09-28
    79 min

    [JFIC-018]Beautiful Legs And A Beautiful Ass Sena Amatsuka

  • angel senna censoredsingle workJFICnctrJFIC-018JFIC0185141jfic00018
    • 2020-10-15

    FC2PPV 1535394 Limited number [None] Amazing I cup northern college student fucking continuous ejaculation (55 minutes)

  • amateur uncensoredfc2
    • 2020-10-24
    117 min

    [NNPJ-409]Amateurs Can Play Too - Picking Up Girls Variety Show! Shy Amateur Guys Get Shown How To Land Super Hot Babes By Pick Up Artist Studs, Then Take Them Back To A Love Hotel For A Creampie!

  • censoredamateurNNPJnanpa japanno directorNNPJ-409NNPJ409nnpj00409
    • 2020-10-24
    166 min

    [CJOD-259]Double Whispering Dirty Talk Made Me Creampie My Brains Out Until My Cock Went Insane Rei Kuruki Ichika Matsumoto

  • satoshi kuruki ichika matsumoto censoredcreampieslutCJODchijo heavensapporo taroCJOD-259CJOD259cjod00259
    • 2020-10-30
    75 min

    259LUXU-1330 Luxury TV 1320 The dental hygienist “Aoi Momoka”, who was captivated by men, is back on Luxury TV! She continues to bloom the talent of Eros, and she is disturbed with her desire and instinct. As an adult woman, she moisturizes

  • amateur censoredbig titsamateurluxuluxu-1330luxu1330259luxu-1330
    • 2020-11-02
    64 min

    [KBTV-037]Will A Girl Who Believes In Horoscopes Fall For Our Fake Fortune Teller？ How Easy Is It To Get Laid If You Tell Her It's Fate？ We Find Out

  • censoredamateurKBTVmessy tvKBTV-037KBTV037h-1514kbtv00037
    • 2020-11-07
    47 min

    [oretd-791]ゆきのちゃん

  • amateur censoredcreampieuniformoretdoretd-791oretd791oretd-791
    • 2020-11-20
    97 min

    [OFKU-165]Fucking My Mother-In-Law From Isesaki To Tokyo... MILF In Her Forties - 45-Year-Old Satomi Fueki

  • satomi fueki censoredcreampiemature womanOFKUstar paradisemom railOFKU-165OFKU165h-254ofku00165
    • 2020-11-24
    46 min

    300NTK-475 H-Cup Yariman Libido Haunted Beautiful Wife … Suddenly Applying For SEX! !! Bottomless SEX greed that is not filled even in the days when three people are saffle and SEX is full of official approval! !! Suddenly inserted into that SEX

  • amateur censoredcreampiebig titsntkntk-475ntk475300ntk-475
    • 2020-11-26
    53 min

    [ykmc-040]エリナ(23)

  • amateur censoredcreampiebig titsykmcykmc-040ykmc040ykmc-040
    • 2020-12-11
    66 min

    FC2PPV 1598207 [Bloomers glossy] Tomoka ¥ Small Kawaiko-chan GET! This girl is … “Bloomers & gym clothes” (correct answer) Crashing vaginal cum shot! Ah … I was actually crazy even on the emergency stairs of a certain apartmen

  • amateur uncensoredfc2
    • 2020-12-12
    120 min

    [MEYD-639]I Went To A Rubber Mat Health Club That Didn't Allow Fucking, And Out Came The Naughty And Haughty Beautiful Married Woman From Next Door. Now That I Knew Her Secret, I Could Demand All The Creampie Sex I Wanted! And I Got To Fuck Her O

  • julia censoredcreampiebig titsMEYDtameike gorohirokoji osakiMEYD-639MEYD639meyd00639
    • 2020-12-13
    151 min

    [CHRV-122]My Little Stepsister Is A Shoplifter Who Hides Her Stolen Wares In Her Cleavage, But She Didn't Realize That Hot Shoplifters Get Fucked! B Is For Busted! L Is For Loose Socks! T Is For Thong! My Little Stepsister Has Big Tits Worth More

  • censoredcreampiebig titsCHRVcherry revolution daydream tribecherry s reboCHRV-122CHRV122chrv00122
    • 2020-12-21
    156 min

    [ONSG-031]Busty Call Girls Mio Kimijima Arisa Hanyu

  • kimishima mio arisa hanyu arisu hanyu censoredcreampiebig titsONSGgain corporationONSG-031ONSG031onsg00031
    • 2020-12-25
    155 min

    [BANK-025]Creampie Sex At An Outdoor Hot Spring - Sweaty Outdoor Fucks! Wild, Cheerful, Busty Babe Who Loves To Get Naughty

  • censoredcreampiebig titsBANKpussy banktake chanBANK-025BANK025h-1495bank00025
    • 2021-01-03
    47 min

    FC2PPV 1630188 Rikako, a Roppongi lounge girl who was deceived by a massage recruitment and abandoned her pride ❤️ Raw squirrel to a slender beauty who stays high ❤️ A sticky villa villa that was used in the pillow business There is a purchase privil

  • amateur uncensoredfc2
    • 2021-01-04
    54 min

    210AKO-414 NOA

  • amateur censoredcreampieamateurakoako-414ako414210ako-414
    • 2021-01-07
    59 min

    413INST-085 Archangel advent! Legal Lori Paipan who was an active idol when I thought it was an amateur layer and personal shooting SEX [Amateur / personal shooting]

  • amateur censoredcreampieamateurinstinst-085inst085413inst-085
    • 2021-01-29
    25 min

    [CLO-119]Ravished In Uniform Maina Yuri

  • yuuri censoredblowjobCLOchobitchchovicCLO-119CLO119h-1435clo00119
    • 2021-01-29
    125 min

    [BANK-028]The Greatest Erotic And Cute Gal, With A Tight Waist! She's So Fucking Cute And She Cums With Spasmic Intensity A Slender Gal Itsuki Hasegawa

  • hasegawa ju censoredsingle workBANKpussy banktake chanBANK-028BANK028h-1495bank00028
    • 2021-02-06
    56 min

    H4610 tk0029 Kiyoka Matsuura 20years old

  • amateur uncensoredh4610
    • 2021-02-11
    121 min

    [GS-375]A Dripping Wet Girl With No Bra And Tiny Tits And Super Erect Nipples She Got Caught In A Sudden Rainstorm During Her Club Activities, And Now Her Tiny Titties And Button-Hard Nipples Were Soaking Wet, Because She Wasn't Wearing A Bra, So

  • censoredblowjobmature womanGSsosoru x garconspada ikebukuroGS-375GS375h-101gs00375
    • 2021-02-12
    151 min

    [IPX-608]Cheating On A Business Trip - Cute Female Employee Made To Share A Room With Her Hung Boss Cums Again And Again Rio Kuriyama

  • rio kuriyama censoredblowjobbeautiful girlIPXidea pocketbungo maedadishIPX-608IPX608ipx00608
    • 2021-02-12
    115 min

    [PARATHD-3109](Emergency Live Broadcast) A Work-From-Home Session Where You're Not Allowed To Give In To The Pleasure A Live Broadcast A Paradise TV Female Anchor Is Cumming Her Brains Out! Complete Edition

  • hebei haruna yuuri censoredPARATHDparadise tvPARATHD-3109PARATHD3109parathd03109
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-28
    72 min

    230OREX-209 Yuri san

  • amateur censoredcreampieamateurorexorex-209orex209230orex-209
    • 2021-03-02
    55 min

    FC2PPV 1708823 [No] [Limited to 100 pieces 2980 → 1480pt OFF!] Mori girl system ♥ First vaginal cum shot for amateurs! ♥ ️ Raw Gonzo ♥ ️ Massive ejaculation in the back of the pussy ♥ ️ * Review privilege / Amateur Kana-chan hard blowjob

  • amateur uncensoredfc2
    • 2021-03-13
    61 min

    10musume 031321_01 Amateur work: Super Curious Nurse Yuko Ikeda

  • amateur uncensored10musume
    • 2021-03-19
    20 min

    10musume 031921_01 Secret Pussy Collection: Kazumi Okada

  • amateur uncensored10musume
    • 2021-04-01
    120 min

    [EMOT-016]Enjoy A Newly Wed Lifestyle With Riho Fujimori In Total POV Style

  • riho fujimori censoredcreampiebig titsEMOTplanet plusdirector oemotionEMOT-016EMOT016h-237emot00016
    • 2021-04-02
    42 min

    480FRIN-026 << Personal Shooting >> Entertainment Talent Big Breasts Super Companion Creampie Hidden Camera at 23 Years Old

  • amateur censoredcreampiebig titsfrinfrin-026frin026480frin-026
    • 2021-04-02
    121 min

    [NDRA-086]The Wife Who Became The Neighbor's Lover 33 Mio Kimijima

  • kimishima mio censoredbig titsmature womanNDRAjet eizomanji groupNDRA-086NDRA086ndra00086
    • 2021-04-08
    71 min

    Caribbeancom 040821-001 The Undisclosed: boob fxxk x 5 Ema Kato, Miyu Ono, Jyuri Haruka, Maki Koizumi, Mirai Hanamori

  • ema kato uncensoredhandjobcaribbeancom
    • 2021-04-14
    120 min

    [SSIS-038]Lay Back And Take It - The Ultimate Soothing Masturbation Experience! (ASMR POV - JOI - Ultra Carnal Footage) Tsukasa Aoi 's Extreme Cock Support

  • tsukasa aoi censoredbig titshandjobSSISs1 no 1 stylekc takedaSSIS-038SSIS038ssis00038
    • 2021-04-16
    62 min

    [tkwa-165]レモン 2

  • amateur censoredcreampieschoolgirltkwatkwa-165tkwa165tkwa-165
    • 2021-04-17
    150 min

    [HND-980]"I Just Want Another Creampie!" I Never Knew She Was Such A Slut... Girlfriend Dotes On Her Boyfriend's Dick - Seductive C***dhood Friend Asuka Asuka Momose

  • momose asuka censoredcreampieuniformHNDhon nakausa pyonHND-980HND980hnd00980
    • 2021-04-17
    236 min

    [REXD-358]Tied Up! Interrogated! And Locked Up! Professional Female Spy "If The Lips On Her Face Won't Talk, Maybe We Should Try The Ones Below..."

  • censoredcreampieREXDredmanji groupREXD-358REXD358rexd00358
    • 2021-04-18
    142 min

    [AGAV-054]A Shamed, Soft And Puffy Bitch - When She Gets Hot And Horny, This Slutty Office Lady Will Fuck Anybody, And Now She's Baring Her Basic Instinct To Fuck - Yuha Kiriyama

  • kiriyama yuu censoredsquirtingbeautiful girlAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-054AGAV054agav00054
    • 2021-04-26
    36 min

    492JCHA-034 I want a woman to talk to me 5

  • amateur censoredschoolgirlamateurjchajcha-034jcha034492jcha-034
    • 2021-04-27
    137 min

    [KNMB-012]Totally Raw [email protected] #A Gal Who Cums Too Much #Blonde And Cute #A Nice Personality #Her First Creampie On Camera #Check Out Her Fuck Face (LOL) #Successful Rough-Riding Creampie Sex #Her First Raw Pay-For-Play Fuck #Simple De

  • riria hido censoredcreampiebeautiful girlKNMBfirst star100 raw styleKNMB-012KNMB012h-491knmb00012
    • 2021-05-07
    50 min

    Caribbeancom 050721-001 3 vaginal cum shots to yukata beauty Emi Aoi

  • emi aoi uncensoredcreampiehandjobcaribbeancom
    • 2021-05-29
    116 min

    241GAREA-515 Nonoka

  • amateur censoredbig titsamateurgareagarea-515garea515241garea-515
    • 2021-06-15
    116 min

    [KIRE-041]Celebrity Yume Nanase AV DEBUT

  • nanase yume censoredsingle workKIREsod createnao masakibeauty kirei sodKIRE-041KIRE0411kire00041
    • 2021-06-20
    130 min

    [NASH-529]This Horny Housewife Loves Cocks, And Now She's Going Behind Her Husband's Back To Have A Secret Meeting With Her Partner In Infidelity And Engage In Plenty Of Deep And Rich Sex So That She Can Satisfy Herself With Her Favorite Deli

  • censoredblowjobNASHnadeshikomitsuo okuNASH-529NASH529nash00529
    • 2021-06-30
    54 min

    FC2PPV 1896411 [No] [Limited to 100 pieces 2980 → OFF to 1480pt!] Astonishment! Newlyweds 5 months pregnant Newlyweds sexual desire can not be suppressed and cheating ♥ ️ Massive vaginal cum shot ♥ ️

  • amateur uncensoredfc2
    • 2021-07-03
    204 min

    [DNJR-053]One Day, One Scene At A Time: Real Orgasm Management Rena Aoi

  • blue censoredslutsingle workDNJRdog daydreamersmaboroshikoDNJR-053DNJR053dnjr00053
    • 2021-07-08
    128 min

    [NEO-761]Coming On Long Hair Miho Tono

  • miho tsuno censoredsingle workNEOradixsakuraba kyuu kokoro otokoneo radixNEO-761NEO761433neo00761
    • 2021-07-11
    92 min

    345SIMM-652 Innocent J ○ is alive in a row! J ○, who seems to be anywhere at first glance, is the most realistic and excited! The shy Aina-chan’s erogenous zone No. 1 is in the back of the vagina regardless of appearance! ？？ For Aina who likes t

  • amateur censoredcreampieuniformsimmsimm-652simm652345simm-652
    • 2021-07-31
    134 min

    [PKPL-008]1 Kitchen Home D***king Document. The Eternally Erotic Comfy Older Sister. All Day Sex For 1 Day With Satomi Suzuki

  • satomi suzuki censoredcreampiebig titsPKPLpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPL-008PKPL008pkpl00008
    • 2021-08-14
    173 min

    [SORA-329]The Slut Of A Girl Who Wants To Show Her J-Series Outdoor Ejaculation Control. Mahiro Ichiki.

  • mahiro ichiki censoredschoolgirlblowjobSORAyama to soradenchuuSORA-329SORA329sora00329
    • 2021-08-14
    60 min

    383REIW-091 Ayase

  • amateur censoredcreampieamateurreiwreiw-091reiw091383reiw-091
    • 2021-08-14
    114 min

    [AARM-009]Nipple Sucking ASMR

  • mihina azumihina mihina nagai nozomi nozomi censoredslutAARMaroma kikakukadowaki shigeoaromaAARM-009AARM009aarm00009
    • 2021-08-15
    56 min

    FC2PPV 2028637 [Individual Shooting 50] Complete Appearance 20-Year-Old Shaved Race Queen I’M Sorry For Squirting I’M Sorry At The End Cleaning Blowjob From Continuous Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-08-29
    72 min

    FC2PPV 2101993 [Pre-Sale] Mayu-Chan, A Tall Slender Beauty, 4th Time-I Was In Heat With A Race Queen Costume And Decided To Make Two Consecutive Vaginal Cum Shots ♥

  • amateur uncensoredfc2
    • 2021-09-16
    101 min

    [ZEAA-065]The Lewd Wife"s Intense Orgasmic Fucking, Hazuki Wakamiya

  • wakamiya censoredcreampiemarried womanZEAAcenter villagemurakithe pole center villageZEAA-065ZEAA065h-086zeaa00065



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored