cosplay censored def jav javcensored




FC2APODMEYDWAAACHRVSSISSHKDHDKAAVSAHMNKBIVENXFSDSSNNPJHODVADNCESDPPPDMIDVMVSDAUKG

2020-11-01
130 min

[VAGU-234]Horny Educated MILF Gets Her Stepson's Best Friend All Tied Up To Take His Creampie - With All Her Refined Dirty Talk He Starts To Like It Eriko Miura

  • miura eriko censoredcreampiebig titsVAGUvenusrokusaburo mishimaultimaVAGU-234VAGU234vagu00234
    • 2020-11-14
    87 min

    FC2PPV 1569417 It is a sequel to the Fcup beauty witch and other married women who first appeared in the first place. ] It’s Gachiero w Conceived NTR 2nd round! Welcome to Affair NTR from a peaceful daily life w Concentrate on the gap of a beaut

  • amateur uncensoredfc2
    • 2020-11-16
    130 min

    [MXGS-1158]A 12-Year Career In Classic Ballet A Young Lady With A Brilliant Smile Hinano Sakura 31 Years Old Her Adult Video Debut

  • hina sakura censoredbeautiful girlsingle workMXGSmaxingkeiha nobuyoMXGS-1158MXGS1158h-068mxgs01158
    • 2020-11-19
    239 min

    [HUNTA-894]She's Unbelievably Turned On Just By Some Light Foreplay! My C***dhood Friend Is Now A Very Cute And Sexy Woman, But She's Had Bad Luck With Men And Mostly Only Used As A Quickie Fuck Buddy Until Now...

  • censoredcreampieschoolgirlHUNTAhuntermorikihhh groupHUNTA-894HUNTA894hunta00894
    • 2020-11-22
    34 min

    FC2PPV 1579129 [First shot, appearance, first vaginal cum shot, uncensored] 19 years old struggling to become an idol First vaginal cum shot of tension and confusion

  • amateur uncensoredfc2
    • 2020-12-25
    53 min

    [oretd-823]Rara

  • amateur censoredcreampieuniformoretdoretd-823oretd823oretd-823
    • 2020-12-31
    160 min

    [BF-624]I Moved Towns For Work And Now My Landlord's Wife Is Trying To Seduce Me - I Ended Up Giving Her My Creampie... Ai Mukai

  • ai mukai censoredcreampieslutBFbefreeroku yonBF-624BF624bf00624
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-29
    129 min

    [DIC-082]A Meaty Boxing Ring Girl Who Loves To Fuck Martial Artists Rika Sasaki Her Adult Video Debut! She's Got A Floor Game That's Practically Illegal As She Burns Through 4 Straight KOs A Complete Game, Undefeated Match Against A Cock!!

  • rika sasaki censoredsingle workDICprestigetsuruhashidiscoverDIC-082DIC082118dic00082
    • 2021-01-30
    149 min

    [MIDE-875]That Swimming Instructor Isn't Aware That She's Showing Off Her Big Tits, And It Really Pisses Us Off, So We All Got Together And G*******ged That Bitch Shoko Takahashi

  • shoko takahashi censoredbig titssingle workMIDEmoodyzmametaro mamezawamoodyz divaMIDE-875MIDE875mide00875
    • 2021-02-01
    62 min

    DIZ-014 Nene

  • amateur censoredcreampieamateurdizdiz-014diz014diz-014
    • 2021-02-05
    50 min

    FC2PPV 1673902 [Uncensored] Rookie J ● The back part-time job of Miss Refre! Serious Seeding Creampie Press for Miriya-chan (19 Years Old) !! J ● Miss Refre: Miriya-chan (19 Years Old)

  • amateur uncensoredfc2
    • 2021-02-06
    240 min

    [DVDMS-626]Facials In The One-Way Mirror Cab - College Girls Only - The One-Way Mirror - College S*****t Amateur Real Guy-Girl Platonic Friends Challenged To Their First-Ever Thigh Sex! When The Two Of Them Are All Alone Together And Cock Rubs Clit,

  • censoredcreampieamateurDVDMSdeep sfunky hasegawathe magic mirrorDVDMS-626DVDMS626dvdms00626
    • 2021-02-18
    149 min

    [PPPD-905]My Girlfriend's Older Sister Tempts Me With Her Big Tits, Telling Me It's OK To Creampie Her - Ranka

  • ranka censoredcreampiebig titsPPPDoppaiPPPD-905PPPD905pppd00905
    • 2021-02-22
    133 min

    [OPPW-087]She Tried Meeting Men Online And Went To Meet Them Ready To Fuck, But They All Turned Out To Be Perverts With Abnormal Fetishes, So, Feeling Unsatisfied, She Decided To Make Her Debut As An AV Porn Actress To Get Her Fill Of Sex! Kanade Asa

  • asahina kanade censoredsingle workOPPWopenipeni world mousouzokuumanosukeOPPW-087OPPW087oppw00087
    • 2021-02-22
    84 min

    [MCKT-016]Hot Girls Who Love To Party! Girls Pick Up Guys To Fuck On The Street Corner Hibiki Otsuki

  • otsuki sound censoredcreampieMCKTchikikikikama delusion groupMCKT-016MCKT016mckt00016
    • 2021-02-26
    134 min

    [ABW-061]*Cheating Chests - Video Of The Worst Impulses On Display - My Girlfriend Promised To Make Me Happy And Ended Up Getting Defiled By Older Guys. Maria Aine

  • maria aine censoredcreampiesingle workABWprestigephnom penhabsolutelyABW-061ABW061118abw00061
    • 2021-02-26
    47 min

    230ORETD-851 Miusan

  • amateur censoredcreampiemarried womanoretdoretd-851oretd851230oretd-851
    • 2021-02-26
    39 min

    FC2PPV 1702827 First shot [Uncensored / Individual shot] Super serious JD plays uniform with his first daddy activity! Forced vaginal cum shot! * Immediate deletion of body

  • amateur uncensoredfc2
    • 2021-03-07
    54 min

    490FANE-32 Hana 2

  • amateur censoredcreampiebig titsfanefane-32fane32490fane-32
    • 2021-03-10
    30 min

    FC2PPV 1720491 [First shot / OL] New ● 23-year-old working at Corsen is the first cum swallowing at Magic Mirror House

  • amateur uncensoredfc2
    • 2021-03-11
    15 min

    HEYZO 2476 A Titty Fuck with Reiko – Reiko Mizuhara

  • reiko mizuhara uncensoredhandjobcumshotheyzo
    • 2021-03-23
    240 min

    [SHIC-205]Legendary Young Hottie Collection Amina-chan 4 Hours

  • censoredcreampiebeautiful girlSHICadolescence.comSHIC-205SHIC205h-839shic00205
    • 2021-03-27
    47 min

    H4610 ori1752 Sayaka Arahashi 20years old

  • amateur uncensoredh4610
    • 2021-04-03
    59 min

    383REIW-052 Natsuki

  • amateur censoredbig titsamateurreiwreiw-052reiw052383reiw-052
    • 2021-04-20
    88 min

    [DOKI-012]Watching An Art S*****t Jerking Off During A Drawing Class!

  • censoredamateurblowjobDOKIstar paradisedokiDOKI-012DOKI012h-254doki00012
    • 2021-04-22
    81 min

    485GCB-012 Aya ● Haruka-like neat and clean beautiful girl vs Gachi love virgin! Real document Gachinko SEX thrown to an actress! [This date course: Minatomirai → Zoo → Love hotel] Erotic, ephemeral, sweet and sour! The most heart-throbbing masterpie

  • amateur censoredamateurgcbgcb-012gcb012485gcb-012
    • 2021-04-24
    127 min

    [KTKC-114](Upload) Charismatic Pick Up Artist Who Loves Big Tits Reveals The Amateur Girl Who Turned Him On The Most Saki (Estimated G-Cup)

  • censoredbig titsamateurKTKCkitixx mousouzokubig titsKTKC-114KTKC114ktkc00114
    • 2021-04-27
    120 min

    [PAIS-003](Forum Posting) I Tried Secretly Filming A Busty, Charismatic Brothel Babe, But When She Caught Me Dominated Me Beyond My Wildest Dreams *If Leaked To The Brothel, This Will Get Taken Down

  • censoredbig titsamateurPAISmercurycricketpie otsukai day clubPAIS-003PAIS003h-1133pais00003
    • 2021-05-07
    42 min

    480FRIN-031 Daddy Live JD 19 Years Old [SEX Video Leaked] Raw Saddle Accepted On A Stealth Trip!

  • amateur censoredcreampieamateurfrinfrin-031frin031480frin-031
    • 2021-05-12
    40 min

    FC2PPV 1814759 Until 19 1480 [None] A gal with a good fair-skinned style of a high-flying car. Threatened with force and vaginal cum shot on a dangerous day.

  • amateur uncensoredfc2
    • 2021-05-18
    53 min

    H0930 ki210518 Mayumi Nakagawa 43years old

  • amateur uncensoredh0930
    • 2021-05-18
    51 min

    H4610 ki210518 Rumi Iwashita 20years old

  • amateur uncensoredh4610
    • 2021-05-28
    55 min

    [OKYH-074]She Blushes When Her Armpits Are Licked! Mayu (22) Probably E-Cups - Want to Enter A Men's Bath With Nothing But A Towel On？

  • censoredamateurOKYHsod createchain sectwhy do not you enter a men s bath with one towelOKYH-074OKYH0741okyh00074
    • 2021-05-28
    120 min

    [MIDE-928]That Summer, I Fucked The Big Titty Supervisor I Was On A Stakeout With Like Crazy... Shoko Takahashi

  • shoko takahashi censoredbig titsslutMIDEmoodyzk westmoodyz divaMIDE-928MIDE928mide00928
    • 2021-05-31
    66 min

    SIRO-4541 [First shot] [Mochi skin x huge breasts JD] [Waist moves ..] A shy and serious music college student has natural huge breasts. Sensitive she who moves her waist freely when she feels comfortable .. AV application on the net → AV experience

  • amateur censoredbig titsamateursirosiro-4541siro4541siro-4541
    • 2021-06-20
    240 min

    [MKMP-403]30 Girls In All: Duo Cast Series, 4-Hour BEST Collection! From Legendary Porn Stars To Up-And-Comers - Deluxe Co-Star Compilation

  • natsuho imai misuzu kawana censoredbig titsbeautiful girlMKMPkm producetaro kmillionMKMP-403MKMP403mkmp00403
    • 2021-06-25
    54 min

    FC2PPV 1888200 [Personal shooting] Immature beautiful young wife and affair Enko! Excited by the female genitals of bristles and vaginal cum shot [Amateur Gonzo]

  • amateur uncensoredfc2
    • 2021-07-13
    71 min

    SDJ-008 Ayumi

  • amateur censoredcreampiebig titssdjsdj-008sdj008sdj-008
    • 2021-07-14
    70 min

    469G-646 Imadoki Girls’ Yen Exchange (daddy Activity) Circumstances! Ayumi

  • amateur censoredcreampiesquirtinggg-646g646469g-646
    • 2021-07-16
    42 min

    FC2PPV 1925653 [None] [Limited To 100 Pieces 2980 → Off To 1480pt! ] Former Local Station Reporter! Appearance Prepared To Wear A Mask That Drastically Reduces Work ♥ ️ Appeal For Vaginal Cum Shot From Yourself! ♥ ️ * Review Benefits / High Image Qua

  • amateur uncensoredfc2
    • 2021-08-12
    120 min

    [FSDSS-270]G*******g At 90 Male Technical School Where S********l Turned Down The Teachers And The S*****ts, Hiyori Yoshioka

  • hiyori yoshioka censoredsquirtingschoolgirlFSDSSfalenoryuuseifaleno starFSDSS-270FSDSS2701fsdss00270
    • 2021-08-14
    61 min

    HEYZO 2591 Thorough Sex With A Hot Busty Beauty! – Honoka Orihara

  • honoka orihara uncensoredcreampieblowjobheyzo
    • 2021-08-18
    47 min

    FC2PPV 2041944 Beautiful Breasts Dental Assistant With A Model Face Showing Off A Superb Blow Job With A Sticky Tongue And Plump Lips 24 Years Old → Cum

  • amateur uncensoredfc2
    • 2021-08-20
    73 min

    [KAZK-065]I Called A Masseuse For My Step Grandma On Her Birthday For A Sensual Massage... Fumie Ogi (61)

  • fumie ogi censoredmomsingle workKAZKstar paradisekazoku star paradiseKAZK-065KAZK065h-254kazk00065
    • 2021-08-22
    98 min

    300NTK-626 [Indecent G Breast Nippon Representative Class Boyne Beauty JD & Slender International Student And Throat 4p Special! !! ] Powerful Big Pie That Jumps Out Of Cosplay! !! Reason Collapses On A Sizzle-Filled Nipple! !! Big Explosion! !! W

  • amateur censoredcreampiebig titsntkntk-626ntk626300ntk-626
    • 2021-08-27
    229 min

    [SKMJ-202]A Real Pickup! With A College Girl With A Body Like A Model! We Dressed Her Up In A Bunny GIrl Outfit And Exposed Her Sexy, Beautiful Legs, And Her Cleavage, And She Wiggled Her Pretty Little Ass As She Extravagantly Pleasured Us With Her S

  • censoredcreampiebig titsSKMJblush girlkikufukuSKMJ-202SKMJ202h-1324skmj00202
    • 2021-09-20
    78 min

    FC2PPV 2228391 Super Popular "Hatsumi Saki" Uncensored Raw Vaginal Cum Shot Outflow 16 / Silent Support ● Sober Daughter First Part (Uniform, Shaving, Shaved, Raw Vaginal Cum Shot, Cum Swallowing)

  • amateur uncensoredfc2
    • 2021-09-25
    131 min

    [LZPL-060]Tongue Heavy Lesbian Kissing Sex, Lewd Lesbian Full Body Drooling. Yumi Saeki ka, Reira Kuon

  • yuka saeki leira haduki censoredlesbianslutLZPLlez reflagmanlez re playLZPL-060LZPL060lzpl00060
    • 2021-10-08
    79 min

    393OTIM-091 [Delusional Subjectivity] Immediately Saddle Ok I Will Lend You A Meat Urinal. 149cm Narumi Natsuki

  • amateur censoredcreampieuniformotimotim-091otim091393otim-091
    • 2021-10-29
    120 min

    [CAWD-310]Overly Respectable Super Slim Beautiful Girl Gets A Filthy Lesson. Locking Her Tight Skinny Body Down For Wet, Wild Teasing And Breaking In. Sumire Kuramoto

  • sumire kuramoto censoredsquirtingdeepthroatCAWDkawaiiarashiyama michiruCAWD-310CAWD310cawd00310
    • 2021-11-21
    115 min

    [083PPP-2292]女の子大好きな美人セラピストが在籍するエステ店を完全盗●(4)～好みの女性客にはマ●コを重点的にマッサージ

  • amateur censoredbig titsamateurpppppp-2292ppp2292083ppp-2292
    • 2021-11-26
    139 min

    [IBW-850]My Wife"s Tanned Half-Japanese Daughter Is Just My Type Ran Height: 145cm Ran Sakita

  • sakita ran censoredbeautiful girlIBWi b worksIBW-850IBW850
    • 2022-01-27
    153 min

    [SPRD-1511]The Reality Is That My Father And Older Brother...Fuck My Wife... Hana Haruna

  • haruna hana censoredmature womansingle workSPRDtakara eizokouji takaraaleddinSPRD-1511SPRD151118sprd01511
    • 2022-02-11
    145 min

    [MIAA-584]A Neat And Clean Female College S*****t Is Sent To Residences With Vigorous Older Men That Are Bursting With Lust And Smell Of Built-up Cum, Getting Taken Advantage Of For Creampie Loads Is An Option. Natsu Tojo

  • natsu tojo censoredcreampieschoolgirlMIAAmoodyzchinpo dazaieveryone porn starMIAA-584MIAA584miaa00584
    • 2022-02-24
    235 min

    [VOV-076]A Massive Collection Of The Strongest Bitches Around! A Chain Reaction Orgy Sex Party Vol.11 "Hey Elder Sister Babe, Would You Introduce Me To A Friend Of Yours Who Is Hornier Than You？"

  • censoredcreampiebig titsVOVit s thursday everyone gatheredorgy from thursdayVOV-076VOV076h-1350vov00076



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored