cowgirl creampie censored jav handjob




FC2SHKDVEMAAUKSATIDHNDADNMIDVSPRDSQTEGVHGMEMRBDWANZAVSAAUKGCESDBBANMILKNGODJUL

2020-12-08
104 min

FC2PPV 1598721 * 1st place reappearance [Individual, uncensored] 20-year-old neat and clean beautiful girl cum shot for the second time in her life. A quiet back girl is crazy with the highest voice acme ever! Massive seeding of uterine puncture with

  • amateur uncensoredfc2
    • 2020-12-11
    191 min

    [ABW-032]The First Ecstasy Of Her Life - Extreme Orgasmic Sex 54 - Beautiful Girl, F-Cup, Cums With Every Part Of Her Body. Remu Suzumori

  • suzumori remu censoredbig titssingle workABWprestigeturkmenistan samejimaabsolutely wonderfulABW-032ABW032118abw00032
    • 2020-12-16
    45 min

    FC2PPV 1608572 [Personal shooting / set sale] 29-year-old married woman who has fallen into customs ① ・ ②

  • amateur uncensoredfc2
    • 2020-12-25
    240 min

    [MBM-253]Fertilize! Heaven's Shame For Cheating Wives! 12 Married Women 4 Hours Of Eating Evil Creampies With Adulterous Sex Betraying Their Husbands

  • censoredcreampieamateurMBMprestigegaro sasazukambmMBM-253MBM253118mbm00253
    • 2021-01-02
    81 min

    [opcyn-142]あめり(29)

  • amateur censoredamateuropcynopcyn-142opcyn142opcyn-142
    • 2021-01-02
    125 min

    [ARM-939]I Will Take Care Of Your Masturbation From Morning Until Night. A Tough Schedule With 6 Ejaculations Per Day!

  • play hatsushima ui censoredanalARMaroma planningmania satoshiaromaARM-939ARM939arm00939
    • 2021-01-16
    122 min

    [PPPD-897]During Our School Trip, I Received Attendance Ticket No.31, Which Meant That I Was The Odd Man Out, So Now I Was Placed In The Same Room As My 2 Big Tits Female Teacher Babes! We Spent The Night Sprawled Out On The Floor To Sleep, But When

  • tomoko kamisaka asuka riina censoredcreampiebig titsPPPDoppaiPPPD-897PPPD897pppd00897
    • 2021-01-20
    120 min

    [SPZ-1091]This Home Helper Old Lady Is Wearing Tight Pants, And Just Asking To Get Pranks Played On Her! This Voluptuously Assed Mature Woman Is Getting Hot And Horny For Erotic Happening Plays

  • chiharu otani fukuyama iroha censoredmature womanSPZstar paradisestar paradiesSPZ-1091SPZ1091h-254spz01091
    • 2021-01-20
    97 min

    [DOKI-010]Me And My Female Senior Got Stuck Alone In A Room After We Missed The Last Train On Our Way Home After A D***king Party.

  • soko manami oura censoredcreampieamateurDOKIstar paradisedokiDOKI-010DOKI010h-254doki00010
    • 2021-02-06
    118 min

    [ADN-290]Licking Hard: Father In Law's Desire 7 - Shihori Kotoi

  • shiori kotoi censoredsingle workdramaADNattackersnaotootona no dramaADN-290ADN290adn00290
    • 2021-02-11
    178 min

    [NHDTB-492]This Office Lady Got A Remote-Controlled Vibrator Shoved Into Her Pantyhose, And Now She's Unable To Withstand The Pleasure As She Dribbles Pleasure Piss Down Her Beautiful Legs

  • censoredsquirtingNHDTBnatural highkansukeNHDTB-492NHDTB4921nhdtb00492
    • 2021-02-16
    57 min

    444KING-028 Nono

  • amateur censoredcreampiebig titskingking-028king028444king-028
    • 2021-03-06
    105 min

    FC2PPV 1713543 Love love date 3 launch edition with the finest idol class innocent lady ❤️ Final chapter [Personal shooting]

  • amateur uncensoredfc2
    • 2021-03-08
    52 min

    492MERC-242 The teacher has already quit …

  • amateur censoredbig titsuniformmercmerc-242merc242492merc-242
    • 2021-03-27
    122 min

    [GONE-031]Hot Curvy Tanned Body - Grab Hold Of Yuri Honma 's Glamorous Booty And Pound Her Hard!

  • really censoredbig titssingle workGONEmercuryan erotic tanned elder sisterGONE-031GONE031h-1133gone00031
    • 2021-03-31
    59 min

    FC2PPV 1748356 A fashionable girl with green hair appears, a shy person, but a lot of disorder of personality sudden change, "Personal shooting" individual shooting original 115th person, raw squirrel

  • amateur uncensoredfc2
    • 2021-04-04
    80 min

    200GANA-2463 Seriously Nampa, first shot. 1618 Secure J Breast College students caught in the prize of Omikuji! I miss her boyfriend … What if I let her spoil her …？ Don’t miss the way you panting with huge breasts! !!

  • amateur censoredbig titssquirtingganagana-2463gana2463200gana-2463
    • 2021-04-06
    122 min

    [KTRA-286]My Big Tits Little Stepsister Lured Me To Temptation With Creampie Sex Akane Shiki

  • akane shiki censoredbig titsuniformKTRAk tribeKTRA-286KTRA286h-094ktra00286
    • 2021-04-09
    169 min

    [JUFE-277]Cum Dumpster With Huge I-Cup Tits Teacher In Training Gets G*******ged And Corrupted By Teachers And S*****ts Rena Momozono

  • reina taoyuan censoredcreampiebig titsJUFEfitchJUFE-277JUFE277jufe00277
    • 2021-05-11
    58 min

    H0930 ki210511 Noriko Kakei 34years old

  • amateur uncensoredh0930
    • 2021-05-12
    16 min

    FC2PPV 1814562 【Only now! ] (Outflow) Tokyo K ③ Famous school big breasts. Things you shouldn’t do [Caution for deletion]

  • amateur uncensoredfc2
    • 2021-05-14
    119 min

    [OKSN-337]Secret Love Affair - Overflowing With Pussy Juice For A Man Who's Not Her Husband - Down For His Creampie And Cum Swallowing - Squirting With Faithless Pleasure - Sensitive, Submissive Married Woman Pleads For Fresh Cock

  • censoredsquirtingblowjobOKSNabc mousouzokuokasan.comOKSN-337OKSN337oksn00337
    • 2021-05-18
    51 min

    H4610 ki210518 Rumi Iwashita 20years old

  • amateur uncensoredh4610
    • 2021-05-25
    58 min

    Pacopacomama 052521_481 Please insert your dick into my pussy! Yukari Ayaka

  • amateur uncensoredpacopacomama
    • 2021-05-28

    FC2PPV 1840074 Limited number [Uncensored] There is a reason to cum inside with a big tits active JD on a reunion date!

  • amateur uncensoredfc2
    • 2021-06-04
    233 min

    [HUNTB-020]A Set Price Fuck-All-You-Want Deal For Anyone! As Long As You Pay The 3-Month Set Price, You Can Fuck Anyone At The School, Whether It's A S********l Or A Female Teacher!

  • censoredschoolgirlblowjobHUNTBhunterkorosukehhh groupHUNTB-020HUNTB020huntb00020
    • 2021-06-11
    141 min

    [MUDR-150]Adolescent Cuckholding My Girlfriend Was Fucked By An Unknown Older Man... Miruku Himeno

  • himeno milk censoredcreampieuniformMUDRmukuMUDR-150MUDR150mudr00150
    • 2021-06-16
    247 min

    [DVDMS-672]A Normal Boys And Girls Focus Group Adult Video These Male And Female Colleagues Are Locked In A Room And They Won't Be Let Out Until They Can Produce 20ml Of Semen! In Order To Get Their Male Colleagues To Cum, These Female Employees

  • censoredcreampiebig titsDVDMSdeep ssuttorune iwanagaDVDMS-672DVDMS672dvdms00672
    • 2021-07-02
    118 min

    [JBD-269]Anal Rope Princess: The Birth Of A True Masochist Girl Alice

  • otsu alice censoredanalbig titsJBDattackersnavejabakuJBD-269JBD269jbd00269
    • 2021-07-09
    122 min

    [MUDR-153]No Groping. Complete Edition Minami Hatsukawa

  • hatsukawa minami censoredcreampiesingle workMUDRmukuMUDR-153MUDR153mudr00153
    • 2021-07-10
    217 min

    [BAZX-298]Thick Sex With A Widow In Mourning Dress vol. 004

  • censoredcreampieBAZXbazookatodoBAZX-298BAZX298bazx00298
    • 2021-07-22
    192 min

    [SW-788]This Big Ass Housewife From The Neighborhood Is A Voluptuous Slut Who Is Luring Me To Temptation By Flashing Panty Shot Action And Giving Me Peeks At Her Black Pantyhose! She's Sitting Their Flashing See-Thru Panty Shot Action At Me, Wait

  • censoredSWswitchyocchanswitch switchSW-788SW7881sw00788
    • 2021-08-07
    123 min

    [BAHP-085]STRAWBERRY PUSSY ASAHINA KAREN Karen Asahina

  • karen asahina censoredcreampiebeautiful girlBAHPbarutanyoshida daibutsuhoppinBAHP-085BAHP085bahp00085
    • 2021-08-17
    60 min

    Caribbeancom 081721-001 When I Returned To Office With A Wet Heavy Rain Showers, My Sexual Harassment Boss Had Sex With Me Rena

  • rena uncensoredcreampiehandjobcaribbeancom
    • 2021-09-03
    43 min

    FC2PPV 2132315 * Limited [Clothing Fucking Pinch] Jcup Gravure-Class Plump Body Aspiring To Be A Voice Actor! Fucking 2 Pinched While Being Gently Blamed With A Soothing Moe Voice!

  • amateur uncensoredfc2
    • 2021-09-03
    60 min

    FC2PPV 2111805 Fluffy Amateur Jd Misaki Who Doesn’T Think About Anything! When I Took It Off, I Had A Super Dangerous Body! Big Natural Boobs And Amazing Constriction! Miracle! Naturally Vaginal Cum Shot! [Individual Shooting]

  • amateur uncensoredfc2
    • 2021-09-04
    121 min

    [BKD-269]Stepmother/Offspring Fucking [Paths To Nakamiyori] Shiori Tsukada

  • shiori tsukada censoredmature womanmomBKDrubytsuji koujitabijiBKD-269BKD269bkd00269
    • 2021-09-09
    60 min

    SIRO-4623 [First Shot] [Small Devil Cowgirl] [Blow Job] An Innocent New Esthetician Who Laughs Cheerfully. A Carnivorous Girl Who Seems To Be Pure, Flirts With Her Cock While Rushing And Shakes Her Hips As If Tossing A Man .. Application Amateur, Fir

  • amateur censoredamateursirosiro-4623siro4623siro-4623
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-23
    125 min

    [ARMF-019]Beautiful Secretary Full-body Encyclopedia No.2

  • aya mamiya ikuta miku censoredanalARMFaroma kikakunyotai fetishismARMF-019ARMF019armf00019
    • 2021-09-25
    61 min

    521MGFX-028 Excavation ☆ Breast Milk Wife

  • amateur censoredbig titsmarried womanmgfxmgfx-028mgfx028521mgfx-028
    • 2021-10-12
    61 min

    SIRO-4662 [First Shot] [Baby Face X Huge Breasts] [Titty Fuck Service] A Jd With Huge Breasts Who Works At A Maid Cafe Has Appeared. A Baby-Faced, Anime-Voiced Girl Shakes Her Huge Breasts Like Her Pendulum, Spinning Shy But Nasty Words. AV Applicati

  • amateur censoredbig titsamateursirosiro-4662siro4662siro-4662
    • 2021-10-22
    99 min

    [VENX-085]In The Family, Beautiful Aunt, Riho Takahashi

  • riho takahashi censoredcreampiebig titsVENXvenuskanieincest vi nasuVENX-085VENX085venx00085
    • 2021-10-22
    120 min

    [JUL-757]A Man And A Woman Under The Same Roof. Drowning In Thick Sweaty Intercourse With The Transparent Housemaid... Rin Okae

  • rin okae censoredbig titsmature womanJULmadonnakimura hiroyukiJUL-757JUL757jul00757
    • 2021-11-01
    123 min

    [AMBI-141]Perverted Step-Dad"s Sex Toy A Beautiful Y********l In Uniform Breaks Up With Her Boyfriend Rion Izumi

  • rion izumi censoredcreampieuniformAMBIplanet plusdirector oanbibarentsuAMBI-141AMBI141h-237ambi00141
    • 2021-11-07
    81 min

    413INST-181 [Back Cosplay Photo Session, Leaked! ] Yang ● Ga Active Idols 174 Cm 24 Years Old Gonzo Photo Session Video With Sports Beauty Fans ★ Gangimari, Seriously Cum Shot Acme (Nozomi Nozomi)

  • amateur censoredcreampiebig titsinstinst-181inst181413inst-181
    • 2021-11-16
    480 min

    [MUCH-140]Really Huge Tits Collection Sex With 10 Girls Fucked One After The Other 8 Hours 2 Discs

  • aoi kuroki enomiya censoredbig titsMUCHmothermuchimuchiMUCH-140MUCH140h-796much00140
    • 2021-11-16
    59 min

    SIRO-4669 [First Shot] [Elegant Appearance] [Sigh That Leaks Indecently] Politeness ○ A Beautiful Tutor Who Has Both Wisdom And Bewitching Advent. The Intense Piston From Her Back Writhes Her Outstanding Style, And While She Has An Ecstatic Expressio

  • amateur censoredamateursirosiro-4669siro4669siro-4669
    • 2021-12-06
    74 min

    SDJ-018 Miri-chan (Sumire Kuramoto)

  • amateur censoredcreampieamateursdjsdj-018sdj018sdj-018
    • 2021-12-09
    97 min

    DCH-019 Akari (Ameri Hoshi)

  • amateur censoredcreampieamateurdchdch-019dch019dch-019
    • 2021-12-24
    156 min

    [CRDD-016]I Put Out An Ad For A Nude Model To Do A Private Photo Session, But Then This Super Cute Model Named Chloe Showed Up, Looking For Sex!？ I Had Raw Creampie Sex With A C*ck-Loving Blonde Beautiful Girl

  • censoredcreampiebig titsCRDDcrazy walkermanjiroCRDD-016CRDD016crdd00016
    • 2021-12-25
    78 min

    [MNSE-027][DIstribution Only] School Uniform JU Nakadashi Individual Filming Yuria Raw Pantyhose Leg Job Pile Driving Cowgirl Press Yuria Hafu

  • yuria hafu censoredcreampieschoolgirlMNSEcrystal eizomaniac plusMNSE-027MNSE027mnse00027
    • 2021-12-30
    61 min

    [123021-001]Secret love with my colleague in a hotel room

  • ryu enami uncensoredcreampiecaribbeancom
    • 2022-01-14
    55 min

    [ETQR-340][Daydream POV] Total Obedience: Babymaking Sex With A Servant Maid On Her Ovulation Day Rina Takase

  • rina takase censoredcreampieblowjobETQRerotic timeETQR-340ETQR340etqr00340
    • 2022-01-22
    248 min

    [KSAT-054]Nasty Aunt Masturbating Everywhere

  • censoredmature womanKSATstrong woman s table daydream tribetable of a strong womanKSAT-054KSAT054ksat00054
    • 2022-01-22
    120 min

    [NEWM-018]Forbidden Sex With My Mother-in-Law Part 22 I Prefer My Mother-in-Law To My Wife... Mitsuyo Ikuno

  • mitsuyo ikuno censoredmature womanmomNEWMglobal media entertainmentyayoi nakanonewmomNEWM-018NEWM018newm00018



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored