creampie censored female college student jav sister




FC2CAWDFSDSSPREDNACRCHRVMARAAVSAAUKGJUFECESDVEMASSNIHDKASANIPXONEZBBANGMEMSDABAPOD

2023-10-21
49 min

GESY-018 An Extremely Likeable Female College Student Whose Breasts Are Punk But Her Dreams For The Future Are A Bit Modest [Consciousness Clouded]

  • amateur censoredcreampiebig titsgesygesy-018gesy018gesy-018
    • 2023-07-14
    160 min

    HMN-420 Rookie 1 Second Before I Cum Immediately! So Sensitive! G Cup God Kubire Active Female College Student Creampie AV Debut! ! Makina Senzoku

  • senzoku makina censoredcreampiesingle workHMNbookmichiru arashiyamaHMN-420HMN420hmn00420
    • 2023-07-07
    150 min

    HUNTB-597 Gaming Harem Live-action Version

  • satsuki mei sarina momonaga censoredcreampieHUNTBhunterkawajirihhh groupHUNTB-597HUNTB597huntb00597
    • 2023-06-30
    260 min

    DVDMS-972 General Men"s And Women"s Monitoring AV In A Special Magic Mirror Room, A Lovey-dovey College Student Couple Breaks Up Into Men And Women And Challenges The Amazing Endurance Of AV Actresses And Actors! ! Cute Erotic Ass Older Siste

  • mizuki yayoi censoredcreampieamateurDVDMSdeepsfunky haseideep sDVDMS-972DVDMS972dvdms00972
    • 2023-06-19
    56 min

    NHDTB-80004 Restraint Slow Piston Rape 4 A Woman Who Was Raped By A Brutal Old Man Who Enjoys The Reactions Until She Slowly Inserts A Raw Cock And Cums Inside Out A Fair-Skinned Female College Student

  • censoredcreampieNHDTBnatural highraftin maeshironatufileNHDTB-80004NHDTB800041nhdtb80004
    • 2023-05-19
    210 min

    HUNTB-480 "There"s A Reason Why I"m Satisfying My Sister"s Libido." Finally I Can"t Tell My Parents "I Can Just Insert A Little Bit"

  • censoredcreampieHUNTBhunterkonjac kanohhh groupHUNTB-480HUNTB480huntb00480
    • 2023-04-21
    178 min

    AKIB-017 Reprinted Thanksgiving Price 1980 Yen Female College Student Only After Drinking Party, Take It Back To The Room, Voyeur And Silently Go To AV No.37 Sexy Older Sister JD Creampie Kumi / J Cup / 21 Years Old (Tall 170cm, Sexy Older Sister Pie

  • amateur censoredslutAKIBone night stand mature woman gammadionAKIB-017AKIB017akib00017
    • 2022-11-24
    197 min

    VOV-094 The Greatest Big Gathering! Rosary Tsunagi Orgy Sex Party Vol.29 “Can You Introduce Me To A Hornier Friend Than Your Sister?”

  • censoredcreampiecosplayVOVit 039 s thursday everyone gatherorgy from thursdayVOV-094VOV094h-1350vov00094
    • 2022-09-23
    130 min

    HUNBL-109 Aphrodisiac Pickled At An Orgy Party I Was Tricked Into Attending! My Older Sister, Who Was Homely And Serious, Has Changed Her Appearance... I'M Supposed To Rescue My Sister, But I'M Forced To Have Incest With My Sister...

  • censoredcreampieHUNBLhuntermikkoro chanhhh groupHUNBL-109HUNBL109hunbl00109
    • 2022-05-30
    73 min

    EROFV-055 Amateur College Girl (Exclusively) Aspiring Female Anchor. Beautiful Woman (Age 21) Miku, Neat And Clean Older Step-sister! Loves Trains, Smart, Pure And Intelligent Girl To Enjoy To The Fullest! Working Hard To Make Sure This Beautiful God

  • censoredcreampieEROFVhamedori.network secondeditionlove girlfriendEROFV-055EROFV055h-1472erofv00055
    • 2022-04-07
    106 min

    GS-430 Inevitable Escape With My Three Little Sister-In-Laws Who Have Big Tits And Are Tempting Sluts! A Life Of Having Sex Over And Over In An Antlion Pit!

  • censoredcreampieschoolgirlGSsosoru x garconoukisosoru garconGS-430GS4301gs00430
    • 2022-02-11
    240 min

    [DVDMS-776]A Normal Boys And Girls Focus Group Adult Video A College Girl And Her Little Stepbrother Are On A Rotating Bed And Playing The 24-Hour Roulette Life Challenge! In A Showa-Era Love Hotel Spin The Wheel And Whatever Excessive Erotic Mission

  • censoredcreampieamateurDVDMSdeepDVDMS-776DVDMS776dvdms00776
    • 2021-11-05
    160 min

    [DVDMS-735]A Normal Boys And Girls Focus Group Adult Video These Stepbrothers And Sisters Are Keeping It In The Family And We Followed Up To See What Was Going On In This Special A Kind And Gentle Big Tits Stepsister And Her Cherry Boy Little Stepbro

  • censoredcreampiebig titsDVDMSdeepssatou tamaoDVDMS-735DVDMS735dvdms00735
    • 2020-07-11
    35 min

    [HHKL-047]I Could See My Little Stepsister's Ass Bulging Out Of Her Knitted One Piece Dress And Her Knee-High Socks, And It Looked So Sexy That I Had To Fuck Her, And So I Creampie Fucked Her Over And Over Again, And As A Result...!？

  • censoredcreampiesisterHHKLhuntercognac kaminohhh groupHHKL-047HHKL047hhkl00047
    • 2020-07-10
    247 min

    [SKMJ-110]"Lately, I've Been Thinking About You, A Lot..." This Horny Little Stepbrother Has Been Seeing His Divinely Beautiful Big Stepsister As A Woman, And So We Bring You This Helpful Variety Special To Solve All Of Those Problems! We

  • censoredcreampieamateurSKMJred face girlxyzSKMJ-110SKMJ110h-1324skmj00110
    • 2020-06-06
    175 min

    [HUNTA-785]My Little Stepsister Was Wearing A Knitted One Piece Dress And Knee-High Socks, And Thrusting Out Her Ass, And I Could No Longer Resist, So I Plunged My Cock Into Her And After Creampie Fucking Her, Over And Over...!？ 2 Once She Became A C

  • censoredcreampiesisterHUNTAhuntercognac kaminohhh groupHUNTA-785HUNTA785hunta00785
    • 2020-05-16
    115 min

    [ROYD-006]Usually My Little Stepsister Is A Cute Plain Jane With A Big Ass, But Then She Started Showing Off The Total Domain Of Her Pussy, And By The Time I Realized What Was Happening, I Had Creampie Fucked her. Akari Neo

  • akari neo censoredcreampiebeautiful girlROYDroyalcognac kaminohhh groupROYD-006ROYD006royd00006
    • 2020-04-28
    164 min

    [EQ-515]Will You Squeeze My Big Tits？ Picking Up Local Amateurs With Big Tits!

  • censoredcreampiebig titsEQbullittrocket taropretty honey brittEQ-515EQ515h-100eq00515
    • 2020-03-14
    240 min

    [DVDMS-518]A Normal Boys And Girls Focus Group Adult Video College S*****t Babes Only A Thrilling Sleepover Mission That Will Test The Bonds Of Stepbrother And Stepsisterhood! If This College Girl Big Stepsister Spends The Night With Her Little Stepb

  • censoredcreampieamateurDVDMSdeep sDVDMS-518DVDMS518dvdms00518
    • 2020-03-06
    169 min

    [EQ-507]Secret Hot Pranks Inside The Futon "Hey!？ My Boyfriend Is Going To Catch Us If We Keep Doing This!" She Got Fucked By Her Boyfriend's Friend And Now She's Enjoying Serious Raw Sex! 3

  • censoredcreampiebig titsEQbullittbalcony fuckingerotic touchingEQ-507EQ507h-100eq00507
    • 2020-02-07
    300 min

    [HEZ-136]Picking Up Amateur Girls - 11 Specially Selected Cute Girls!

  • censoredcreampiebig titsHEZhot entertainmentnetsuyujinHEZ-136HEZ13659hez00136
    • 2019-12-10
    123 min

    [EQ-492]Secret Hot Pranks Inside The Futon "Hey!？ My Boyfriend Is Going To Catch Us If We Keep Doing This!" She Got Fucked By Her Boyfriend's Friend And Now She's Enjoying Serious Raw Sex! 2

  • censoredcreampiebig titsEQbullittshuzo kuriyamaitazuraEQ-492EQ492h-100eq00492
    • 2019-11-02
    196 min

    [HUNTA-675]My Stepsister's Ass Is Sticking Out Between Her Knitted Dress And Her Knee-High Socks, And I Just Can't Keep My Hands Off Her! I Fuck Her And Creampie Her Again And Again!

  • censoredcreampiesisterHUNTAhuntercognac kaminohhh groupHUNTA-675HUNTA675hunta00675
    • 2019-11-02
    306 min

    [HUNTA-678]"No Way! What Are You Doing？! If You Move So Fast, I'm Going To Cum Too Soon!" - Sister-In-Laws Grind Their Hips Riding Cowgirl Style On Their Brother-In-Laws' Cocks!

  • censoredcreampiesisterHUNTAhuntervolvo nakanohhh groupHUNTA-678HUNTA678hunta00678
    • 2019-10-25
    248 min

    [MDTM-571]Hikaru Minazuki Best Hits Collection 4 Hours

  • hikaru minazuki censoredcreampieschoolgirlMDTMmedia stationuchu kikakuMDTM-571MDTM57161mdtm00571
    • 2019-05-05
    242 min

    [DVDMS-395]Observation Porn Featuring Ordinary Men And Women. College Students Only. A Thrilling Sleepover Mission To Test The Bond Between A Brother And Sister! If A College Girl Spends A Night In The Same Room With Her Younger Brother Who Has Taken

  • censoredcreampieamateurDVDMSdeep sgreenhouse effectDVDMS-395DVDMS395dvdms00395
    • 2019-04-11
    245 min

    [SDAM-015]Cherry Boy Little Stepbrother Touches His Mature Older Stepsisters Body And Gets Hard Even Know He Knows Its Wrong, Will It Turn Into "Forbidden Fakecest" Or What？! 9

  • censoredcreampiesisterSDAMsod createyazawa ready to receiveSDAM-015SDAM0151sdam00015
    • 2019-03-10
    154 min

    [IPX-288]A Literature Student From A Prestigious University Makes Her Porn Debut In Search Of Someone To Cum Inside Her! She Loses Her Virginity At A Social Mixer During The Summer Of Her Freshman Year! This Girl Suddenly Takes Loads From 40 Differen

  • censoredcreampieIPXidea pockettake ddishIPX-288IPX288ipx00288
    • 2019-03-08
    160 min

    [MDBK-013]I Had An Unexpected Encounter With A Super Cute Girl Who's The School Idol At My College When I Booked A Date With An Escort! The Girl I Have A Crush On Enjoys Herself With My Dick!! Aoi Kururugi, Mikako Abe , Kurumi Tamaki, Mai Yahiro

  • aoi kururugi abe mikako censoredcreampieMDBKmedia stationk tarobazookaMDBK-013MDBK01361mdbk00013
    • 2019-02-10
    141 min

    [DVAJ-376]A Little Sister Gets Creampied By Her Insatiable Brother Who Won't Stop Fucking Her Even When Their Parents Come Home. Makina Yui

  • knotted censoredcreampiesisterDVAJalice japanbieber gonzoDVAJ-376DVAJ376dvaj00376
    • 2019-02-10
    120 min

    [EQ-440]Hot Plays Underneath The Foot Warmer "Hey!？ My Boyfriend Is Gonna Find Out!" She Got Fucked By Her Boyfriend's Friend, And Now She's Seriously Having Raw Creampie Sex!

  • censoredcreampiebig titsEQbullittshuzo kuriyamaitazuraEQ-440EQ440h-100eq00440
    • 2018-11-01
    114 min

    [NACR-188]The Big-Booty Art-School Babe: I Asked My Big Brother to be My Nude Model, When I Got too Excited and He Came Inside Me. Tsubasa Hachino

  • yano tsubasa censoredcreampiebig titsNACRplanet plusbirdman teppeinanakuruNACR-188NACR188h-237nacr00188
    • 2018-09-29
    150 min

    [JUFD-967]The College Girl With Colossal Tits Is Taught To Orgasm Easily By The Techniques Of A Middle-Aged Man. Monami Takarada

  • takarada monami censoredcreampiebig titsJUFDfitchJUFD-967JUFD967jufd00967
    • 2018-09-29
    118 min

    [MIMK-059]My Big Sister And Me Toro Toro Sticky Sex Tomoe Nakamura

  • tomoe nakamura censoredcreampiebig titsMIMKmoodyzkitorune kawaguchimankitsuMIMK-059MIMK059mimk00059
    • 2018-04-01
    163 min

    [DVDMS-241]A Normal Boys And Girls Focus Group AV On The Other Side Of That One Way Mirror Are Their Parents! This Kind And Gentle Big Tits Big Sister Is Taking The 100,000 Yen Per Fuck Challenge With Her Little Brother, Who Is Still A Cherry Boy! 2

  • censoredcreampieamateurDVDMSdeep sfunky hasegawathe magic mirrorDVDMS-241DVDMS241dvdms00241
    • 2018-01-25
    135 min

    [SDMU-765]This Little Brother Has A Crush On His College Girl Big Sister, So She Pretended To Miss The Last Train Home, And They Spent The Night In A Love Hotel For The First Time Ever, And She Decided To Lure His Cherry Boy Ass To Temptation When He

  • censoredcreampieamateurSDMUsod createakira saijoSDMU-765SDMU7651sdmu00765
    • 2017-08-11
    141 min

    [SUPA-220]Real College Girl's Raw Creampie Life 10

  • censoredcreampieamateurSUPAs kyuu shiroutok tarouSUPA-220SUPA220h-244supa00220
    • 2017-06-09
    143 min

    [SUPA-188]Real College Girl's Raw Creampie Life 9

  • censoredcreampieamateurSUPAskyu shirotok taroSUPA-188SUPA188h-244supa00188
    • 2017-02-05
    123 min

    [DVDMS-082]Big Sister Fucking Rec-4 A Raw And Extreme Video Posting A Cherry Boy Little Brother Loses His Mind When His Big Sister Keeps Flashing TItty And Panty Shot Action At Him Total Video Coverage Of Incest Filmed Without Their Parents' Know

  • censoredcreampiesisterDVDMSdeep shiromichi miyaseDVDMS-082DVDMS082dvdms00082
    • 2017-01-02
    160 min

    [DVDMS-070]A Normal Boys And Girls Focus Group AV On The Other Side Of That One Way Mirror Is Her Little Brother! A Big Tits College Girl Is Together With Her Little Brother's Friend And Taking On The Consecutive Creampie Sex Challenge equal 100,

  • censoredcreampiebig titsDVDMSdeep 039 sjohann yuanDVDMS-070DVDMS070dvdms00070
    • 2016-11-04
    145 min

    [DVDMS-050]Big Sister Rape Rec-3 Extreme Posting Videos A Cherry Boy Little Brother Obsessed With His Titty Flashing Panty Shot Big Sister Goes Psychotic While Their Parents Are Away, And Now We Bring You The Full Video Story That We Filmed Of Their

  • censoredcreampiesisterDVDMSdeep shiromichi miyaseDVDMS-050DVDMS050dvdms00050
    • 2016-05-15
    119 min

    [PPPD-470]Current College Girl. Busty Creampie Tutor (Special Edition) An Sasakura

  • an sasakura censoredcreampiebig titsPPPDoppaiPPPD-470PPPD470pppd00470
    • 2015-11-14
    117 min

    [PPPD-416]Current College Girl. The Busty Creampie Tutor Yuni Oi

  • yui oi censoredcreampiebig titsPPPDoppaiPPPD-416PPPD416pppd00416
    • 2015-02-15
    152 min

    [PPPD-348]Busty College Girl Tutor JULIA

  • julia censoredcreampiebig titsPPPDoppaiPPPD-348PPPD348pppd00348
    • 2014-08-14
    119 min

    [PPPD-309]Real Life College Girl Private Tutor With Big Tits Takes Creampies Riko Honda

  • honda censoredcreampiebig titsPPPDoppaiPPPD-309PPPD309pppd00309
    • 2014-06-14
    118 min

    [PPPD-296]Huge Tits and Creampies: College Girl Private Tutor Mikan Kururugi

  • mandarin orange censoredcreampiebig titsPPPDoppaiPPPD-296PPPD296pppd00296



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored