creampie high vision censored jav nampa




FC2MVSDMARANACRMEYDFSDSSHNDAMBIBLKGVHAUKGDASDCHRVSQTEVEMAMILKCESDCAWDDTTSDABSAN

2020-10-09
79 min

300NTK-438 G Big Breasts Bitch White Gal Senior Pleasure 100 Times Giving Back! !! Thank you to the estimated 1000 over Yariman Bitch senior who became a sex practice table! !! However! !! The evolved Yariman’s interception masterpiece Ma Ko is

  • amateur censoredcreampiebig titsntkntk-438ntk438300ntk-438
    • 2020-10-11
    118 min

    [AVSA-142]SUPER FISHEYE FETISHISM: Powerful Excitement Honey Photo, Plump Sensual Erotic BODY - Saya Minami

  • minami saya censoredbig titssingle workAVSAavs collector sbuddha davscollector sAVSA-142AVSA142avsa00142
    • 2020-10-16
    52 min

    330PER-315 Mai

  • amateur censoredamateurperper-315per315330per-315
    • 2020-10-27
    58 min

    FC2PPV 1548487 [Personal shooting] Natural loose fluffy amateur wife Akiho’s raw squirrel mass cum shot!

  • amateur uncensoredfc2
    • 2020-11-01
    64 min

    324SRTD-0194 Bring a big tits shaved married woman with a hard guard to the room and the second round! AV actor Nampa Gonzo secret video

  • amateur censoredbig titsmarried womansrtdsrtd-0194srtd0194324srtd-0194
    • 2020-11-09
    80 min

    FC2PPV 1564129 [Uniform Clothes Saddle Creampie & Squirting] I have assisted with my Echiechi daughter with a matching app! Even though it’s so cute, jungle pubic hair! The untreated bristle pussy that is left raw is bechobecho with man juic

  • amateur uncensoredfc2
    • 2020-11-13
    33 min

    [CLO-094]The Kind Of MILF I'd Like To Deep Kiss Risa Kasumi

  • kasumi risa censoredblowjobCLOchobitchchovicCLO-094CLO094h-1435clo00094
    • 2020-11-19
    149 min

    [PPPD-883]Her Boyfriend Made This Big-Titted Girl Abstain From Beast For 30 Days And Now She's Turned Into A Horny Beast So I Went Ahead And Fucked Her First, Over And Over Again - Nao Nakano

  • nanao nakano censoredcreampiebig titsPPPDoppaiPPPD-883PPPD883pppd00883
    • 2020-11-26
    93 min

    [OKS-100]Slick, Slippery, Glistening - Indulge Your Senses With Hikaru Minazuki In A School Swimsuit! Peeping Voyeur Footage Inside The Change Room With Close-Ups From Tiny Boobs To Big Tits, Shaved Pussy, Pubic Hair, And Under Arms, Plus Lotion And

  • hikaru minazuki censoredbeautiful girlsingle workOKSdaddy s private photosgoddess in a school swimsuitOKS-100OKS1001oks00100
    • 2020-11-27
    56 min

    [tkwa-135]カレン 2

  • amateur censoredcreampieamateurtkwatkwa-135tkwa135tkwa-135
    • 2020-11-27
    87 min

    [EKW-064]東京痴●女 凛音とうか

  • roaring sound censoredbig titsslutEKWwaap entertainmentk westcobraEKW-064EKW0642ekw00064
    • 2020-11-28
    187 min

    [JUFE-229]An Amateur Wife Who Would Rather Get Fucked By Other Men Than Her Husband Is Making Her Adult Video Debut In This Totally Raw Exclusive Footage Fuck Fest! Shuka Sezuki 40 Years Old This Real-Life Secretary Is Shooting Her First Video, But Y

  • akihana sezuki censoredsingle workJUFEfitchJUFE-229JUFE229jufe00229
    • 2020-12-17
    46 min

    285ENDX-321 Azato Kawaii 23-year-old OL Handsome opponent with explosive age and sensitivity and tension

  • amateur censoredcreampiesquirtingendxendx-321endx321285endx-321
    • 2020-12-25
    234 min

    [SKMJ-138]Large Assed Amateur College Girl Gets Her Fat Butt Shaken By Human Battle Piston Fuck As Her Legs Tremble! Getting Her Fleshy Ass Firmly Grabbed, Her Asshole Closely Inspected And Thoroughly Licked, Shaking Her Ass At High Speed While A Coc

  • censoredcreampieamateurSKMJred face girlone topSKMJ-138SKMJ138h-1324skmj00138
    • 2021-01-02
    40 min

    361SEKAO-144 Misty from L.A

  • amateur censoredamateursekaosekao-144sekao144361sekao-144
    • 2021-01-07
    54 min

    H0930 ki210107 Ritsuko Harada 32years old

  • amateur uncensoredh0930
    • 2021-02-05
    241 min

    [BUR-565]Posting Of A Itty Bitty Babes! The Size Of Their Raging Lust Doesn't Match Their Bodies! 24 Incredible Barely Legal Cuties! Finger-Banging Self Shot Masturbation 4 Hours

  • censoredbeautiful girlBURglay zburst graceBUR-565BUR56512bur00565
    • 2021-02-12
    80 min

    [YMDS-020]Massive Cocks For Hire Anytime, Anywhere - Aya, Their Client, An Absolute Nympho With Colossal Tits - Splash Monster

  • censoredsquirtingblowjobYMDSmomotaro video publishingdukeyoung peachYMDS-020YMDS020ymds00020
    • 2021-03-06
    92 min

    FC2PPV 1713086 Limited to 200 pieces, 2480 PT! [No individual shooting, miracle appearance beauty, full-scale blowjob, challenge the limit! Non-stop 3 barrage cum swallowing] Eimi-chan, a beautiful woman with a long tongue and god tech that can only

  • amateur uncensoredfc2
    • 2021-03-11
    93 min

    [OKS-107]Slick, Sweaty, Intimate Sex In A Nut-Busting School Swimsuit - Akane Shiki - Enjoy Her At Her Wettest! Hidden Camera Voyeur Footage From The Change Room - From Tiny Boobs To Big Tits, Shaved Pussy, Hairy Snatches, And Armpits - Plus Close-Up

  • akane shiki censoredschoolgirlbeautiful girlOKSdaddy s private photosgoddess in a school swimsuitOKS-107OKS1071oks00107
    • 2021-03-26
    136 min

    [MIDE-904]My Older Coworker Invited Me To Her House For A Party And Then... All You Can Fuck Buffet With My Boss's Wife! Minami Hatsukawa

  • hatsukawa minami censoredcreampiesingle workMIDEmoodyzzaku araimoodyz divaMIDE-904MIDE904mide00904
    • 2021-04-22
    60 min

    10musume 042321_01 Cute Costume : This Maid on G-strings Serves Freaky Stuffs Minami Fujisawa

  • amateur uncensored10musume
    • 2021-04-23
    120 min

    [MIAA-425]Convulsion Pleasure With Sexy Oil Aggressively Licking Her Pussy After She Already Came AIKA

  • aika censoredbig titssquirtingMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-425MIAA425miaa00425
    • 2021-05-07
    158 min

    [EBOD-824]She's Down With All The Creampie Sex These Hung Amateur Guys Can Give Her! This Massage Parlor Slut With Colossal Tits Has Got A Cum Fetish And She's Here For Yours. Risa Dan

  • rinsha dan censoredcreampiebig titsEBODe bodyhirokoji osakiEBOD-824EBOD824ebod00824
    • 2021-05-07
    152 min

    [IPX-666]"If You've Missed The Last Train Home, Why Don't You Come Over To My Place" My Girlfriend Was Waiting For Me At Home, But After I Missed The Last Train Home, I Decided To Spend The Night At My Female Colleague's Place ...

  • minami aizawa censoredblowjobslutIPXidea pocketkahori maedanodishIPX-666IPX666ipx00666
    • 2021-05-09
    56 min

    FC2PPV 1804900 [56 minutes 6 shots] Nowadays again. Uncut Creampie Cum ＃ 8

  • amateur uncensoredfc2
    • 2021-05-15
    49 min

    481SACZ-028 Setsuko 4

  • amateur censoredamateurmature womansaczsacz-028sacz028481sacz-028
    • 2021-05-21
    116 min

    [JUL-574]I'll Never Tell My Wife About How I Knocked Up My Mother-In-Law... I Threw Caution To The Wind Out Of Lust And Had Creampie Sex On Our One-Night, Two-Day Hot Spring Vacation. Ai Kano

  • ai kano censoredcreampiebig titsJULmadonnamametaro mamezawaJUL-574JUL574jul00574
    • 2021-05-28
    144 min

    [CLUB-642]I Have A Fetish For School Swimsuits, So I Like To Secretly Film Girls With Big Tits In School Swimsuits. Creampie Sex Using My Horny Cock, From Start To Finish.

  • censoredcreampiebig titsCLUBhentai shinshi clubCLUB-642CLUB642club00642
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-24
    57 min

    413INST-133 Orgy 5P] H & F Cup Big Breasts ♀ x2 and swallowing raw squirrel orgy (20) (25) Dick and pussy raw squirrel all over the house, full of sake, sperm and tide

  • amateur censoredcreampiebig titsinstinst-133inst133413inst-133
    • 2021-06-30
    79 min

    FC2PPV 1896952 Until 7/7 1480 [Nothing] A young wife with beautiful legs in Latin ass. After she enjoys herself at the hotel, she commits her vagina with multiple sticks at the hotel.

  • amateur uncensoredfc2
    • 2021-07-02
    137 min

    [HUNTB-042]Staying Together With This Female Cheerleading Squad And My Cock Is Their Only Relief! Intense Training And A Life Of Abstinence Makes Them Sexually Frustrated And The Members And I Have An Unexpected Harlem Orgy With Creampies! Furthermor

  • censoredcreampieschoolgirlHUNTBhuntercognac kaminohhh groupHUNTB-042HUNTB042huntb00042
    • 2021-07-04
    46 min

    404DHT-0108 Ryoka 37 years old, an erotic masseuse who invites customers in the cleavage

  • amateur censoredamateurdhtdht-0108dht0108404dht-0108
    • 2021-07-04
    54 min

    GERK-382 A-san

  • amateur censoredcreampiebig titsgerkgerk-382gerk382gerk-382
    • 2021-07-14
    62 min

    478LOLI-038 Chisa

  • amateur censoredcreampieschoolgirlloliloli-038loli038loli-038
    • 2021-07-17
    62 min

    FC2PPV 1926505 [Advent Of The Stakeout Goddess] Innocent Jd Miriya-Chan (20 Years Old) Go To Heaven ♡

  • amateur uncensoredfc2
    • 2021-07-23
    160 min

    [LULU-085]We Were Working Overtime, So I Had This Newly Graduated Big Tits Colleague (And She's A Serious Pushover) Model Some Underwear For Me, And When I Saw Her Bashfully Modeling Some Tantalizing Lingerie, I Got An Unstoppable Hard On, And No

  • ena koume censoredcreampiebig titsLULUlunaticsluminaxLULU-085LULU085lulu00085
    • 2021-08-14
    61 min

    HEYZO 2591 Thorough Sex With A Hot Busty Beauty! – Honoka Orihara

  • honoka orihara uncensoredcreampieblowjobheyzo
    • 2021-09-02
    64 min

    FCP-038 [Delivery Only] Muchipuri Best Ass Job! !! ＃ 2 I’ll Make You Feel Good With My Big Ass …! !!

  • amateur censoredamateurslutfcpfcp-038fcp038fcp-038
    • 2021-09-02
    50 min

    FC2PPV 1920442 [Personal Shooting] Appearance Narumi 20 Years Old G Cup Duero Body Plump Daughter With Super Big Cock Cum Shot! !!

  • amateur uncensoredfc2
    • 2021-09-20
    97 min

    [SPZ-1114]Surprisingly Easy To Seduce! Older Masseuse At A Business Hotel 2

  • censoredamateurmature womanSPZstar paradisesuta paradaisuSPZ-1114SPZ1114h-254spz01114
    • 2021-09-20
    120 min

    [UDAK-007]"Never Let Your Guard Down ..." "I"m Sure You Have No Interest in An Old Lady Like Me, With My Big Meaty Ass？" Erotic Teasing Plays With A Mature Woman Home Helper With A Big Meaty Ass

  • kazuna tsukihara akiyo matsubara censoredmature womanUDAKstar paradiseyudakimoUDAK-007UDAK007h-254udak00007
    • 2021-09-26
    165 min

    300MAAN-701 [God Beauty & Miracle Harem Orgy With God Beauty! 2.5h Legend Sp! ] An Idol-Class T ☆ Kt ● Ker That Shines Brightly In The Night Pool And An Obscene Party Begins! Climax From The Beginning! Paradise Harlem Sex With God Tech Service Ser

  • amateur censoredcreampiesquirtingmaanmaan-701maan701300maan-701
    • 2021-10-01
    160 min

    [JUFE-335]An Old Geezer"s POV Documentary: Dripping Wet Sex And Sticky Bodily Fluid Ingestion, Starring Rino Yuki

  • yuki rino censoredcreampiebig titsJUFEfitchJUFE-335JUFE335jufe00335
    • 2021-10-02
    89 min

    390JAC-111 [Super Beautiful Ass X Mechakawa Lady X Saddle Tide Ma ● Ko] Legendary Erotic Striker Who Is Active In Selye H Has Appeared! A Vaginal Cum Shot Goal Is Confirmed At The Woman On Top Posture With A Trained Trunk! ？？ If You Blame Your Body F

  • amateur censoredcreampiesquirtingjacjac-111jac111390jac-111
    • 2021-10-03
    47 min

    358WITH-106 Ema (19) S-Cute With Masturbation-Loving Black-Haired Beauty And Gonzo H (Choyo Ema)

  • amateur censoredamateurbeautiful girlwithwith-106with106358with-106
    • 2021-11-20
    135 min

    [APKH-191]Beautiful Breasts School Uniform Girl, Hot Spring Trip With A Dominant Teacher And Creampie Sex Education.

  • yoshimi hono censoredcreampieschoolgirlAPKHaurora project annexhaurora project anexAPKH-191APKH191apkh00191
    • 2021-11-26
    216 min

    [SKMJ-230]This Innocent Sch**lgirl Is Inserting Three Fingers Into Her Pussy And Filming Herself In A Dripping Masturbation Session! Immediately After Cumming, She Gets A Big Dick Slammed Into That Wet P*ssy For Some Quickie Fucking! "Nooooo! I J

  • censoredcreampieuniformSKMJred face girlone topSKMJ-230SKMJ230h-1324skmj00230
    • 2021-11-26
    23 min

    FC2PPV 2466412 Last 100! "# 15" Apparel Clerk. She Is A Black-Haired Gal Who Is Quietly Panting And Tightening. Hold The Pillow For The Pleasure Of Raw Insertion ♡ Yes Piece ♡

  • amateur uncensoredfc2
    • 2021-12-10
    147 min

    [IPX-770]Her Boss Creeped Her Out So Badly, She"d Rather Die Than Fuck Him, But He Made Her Cum Over And Over Again With His Big Dick, And She Couldn"t Handle The Shame Mai Kanami Got Marked With Her Perverted Boss" Semen

  • kanna mimai censoredsingle workdramaIPXidea pocketamazing meatdishIPX-770IPX770ipx00770
    • 2021-12-24
    164 min

    [HMN-091]Akari Mitani, The Ass Bitch Staking Lascivious Nurse Who Makes You Lick Her Twitching Anus Late At Night And Invites You To Cum In Her Pussy.

  • mitani akari censoredanalcreampieHMNhon nakamametaro mamezawaHMN-091HMN091hmn00091
    • 2022-01-10
    93 min

    345SIMM-687 Y-Chan @ Shibuya [Neat / Black Hair / Ponite / Student / Miniskirt / Raw Feet / Beautiful Legs] #Underwear Voyeur #Train Molester #Home Invasion #Sleep Fuck

  • amateur censoredcreampieamateursimmsimm-687simm687345simm-687
    • 2022-01-14
    52 min

    [ETQR-344][Daydream POV] The Slut Tempts You By Wearing A Maxi Dress To Show Off Her Obscene Figure. MIU.

  • censoredcreampiebig titsETQRerotic timeETQR-344ETQR344etqr00344
    • 2022-01-21
    45 min

    FC2PPV 2610114 [No Personal Photography] Present Of S-Class G-Cup Beauty. Massive Injection Of Magical Hormones-Enjoy The Finest Cracks! !! Hana (25 Years Old)

  • amateur uncensoredfc2
    • 2022-01-28
    115 min

    [EKW-077]Control by Deep Kiss. Kana Morisawa.

  • kana morisawa kanako iioka censoredblowjobslutEKWwaap entertainmentk westcobra warpEKW-077EKW0772ekw00077



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored