creampie jav def amateur voyeur




FC2PREDGMEMKSBJMARACESDSTARSVEMAGVHWAAASDABNNPJFSDSSSQTEATIDNACRNATRSPRDCAWDDASDHMN

2020-12-11
59 min

FC2PPV 1602487 * Limited price for 3 days 3980⇒2980pt! ★ Super rare amateur ♥ Minami-chan, 22 years old of beautiful leg race queen, is coming again! ☆ Baptized dismissal beauty BODY is bicubic lust ♥ Beautiful leg footjob is heaven ♥ Gonzo raw squir

  • amateur uncensoredfc2
    • 2020-12-18
    96 min

    [VEMA-154]A 3-Day, 2-Night Creampie School Trip Where All The Boys Join So They Can Fuck The Colossal Tits Female Teacher June Lovejoy

  • june lovejoy censoredcreampiemature womanVEMAvenuspetermegami venusVEMA-154VEMA154vema00154
    • 2020-12-27
    150 min

    [DBER-095]A Beautiful Girl Who Lost Her Mind And Wept A Sweet Housewife Who Came Excessively And Endlessly Her Luscious Body Kept On Cumming Past All Limits As She Desperately Thrashed And Struggled To Hold Herself Together Ravaging Videos RED BABE U

  • censoredbeautiful girlDBERbabyentertainmentred babeDBER-095DBER095dber00095
    • 2020-12-29
    87 min

    FC2PPV 1624838 Reina challenges SM training sex for the first time ❤️❤️ Saliva, love juice and serious juice dripping … [Personal shooting]

  • amateur uncensoredfc2
    • 2021-01-08
    190 min

    [GNAB-046]We Talk To Part-Time Staff At A Love Hotel! Will They Help Cherry Boys Jerk Off？ - They Spend All Day Cleaning Up After Other People Having Sex, Now It's Their Turn! - Their Loving Affection Gets The Guys Hard Immediately And They Let T

  • censoredamateurGNABprestigeelectric trainbang prestigeGNAB-046GNAB046118gnab00046
    • 2021-01-09
    138 min

    [JUFE-249]I Lost Control When Our Parents Were Off On Their Honeymoon And Wound Up Fucking My Younger Stepsister - Memories Of Youth. Miu Narumi

  • narumi miu censoredschoolgirlblowjobJUFEfitchJUFE-249JUFE249jufe00249
    • 2021-02-07
    144 min

    [TSF-013]You Used To Be An Otaku Boy, But When You Wake Up In The Morning, You Find That You Have Now Transformed Into A Woman (33) A Thorough Investigation This Man Used To Be An Otaku, But Now He's Been Reborn As A Beautiful Girl Who Looks Good

  • tetsuya sekine censoredcreampiebig titsTSFkaguyahimept mousouzokugynecomastia reportTSF-013TSF013tsf00013
    • 2021-02-12
    96 min

    300NTK-517 “I want more …” G cup Echi Echi Megumi cute junior! !! really! !! really! !! Straight! !! Too cute too erotic God correspondence! !! Co-co wanting is a binkan constitution! !! Beloved and foolery getting wet with a kiss! !!

  • amateur censoredcreampiebig titsntkntk-517ntk517300ntk-517
    • 2021-02-17
    120 min

    [GVH-198]A Son-in-law Targeting His Mother-in-law's Big Tits - Riko Tokushima

  • riko tokushima censoredcreampiebig titsGVHgloryyellow cherryGVH-198GVH19813gvh00198
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-26
    106 min

    504TNNN-001 Makki

  • amateur censoredbig titsamateurtnnntnnn-001tnnn001504tnnn-001
    • 2021-02-27
    60 min

    SIRO-4429 [First shot] [Flowing delicate body] [Penetrating big cock ..] A professional student who wants to make up, fascinating cuteness like a small animal. It must have been a revenge for the boyfriend who was cheating .. AV application on the ne

  • amateur censoredamateursirosiro-4429siro4429siro-4429
    • 2021-03-11
    50 min

    Pacopacomama 031121_445 Horny Wife Helps to Lose Younger Boy’s Virginity 2 Kanon Mikoshiba

  • amateur uncensoredpacopacomama
    • 2021-03-21
    141 min

    [DASD-835]The Story Of A Woman Who Wanted To Get Pregnant With Her Beloved Husband But Ended Up Being Impregnated By The Fertility Specialist! Yu Shinoda

  • shinoda yu censoredcreampiesingle workDASDdasrokusaburo mishimaDASD-835DASD835dasd00835
    • 2021-04-01
    78 min

    [REBD-545]Mei Maybe Angel/Mei Miyajima

  • mei miyajima censoredsingle workREBDrebeccachikara sawamuraREBD-545REBD545h-346rebd00545
    • 2021-04-12
    102 min

    [DORI-016]Fuck Films No. 16 - Beautiful Tits With Puffy Pink Nipples - Carefree S********l Says No To Gross Older Guys, But She Happily Takes Their Cocks Anyhow!

  • censoredbig titsuniformDORIfirst starpaco shootingDORI-016DORI016h-491dori00016
    • 2021-04-18
    159 min

    [DGCESD-999]*For Streaming Editions Only! Cums With Bonus Footage* This Horny Bitch Will Piss Herself Silly And Explode With Lust Whenever She Puts Her Glasses On 2 Ayaka Mochizuki

  • ayaka mochizuki censoredsquirtingmature womanDGCESDcelebrity friendsDGCESD-999DGCESD999dgcesd00999
    • 2021-06-03

    FC2PPV 1851396 [Individual shooting 40] Complete appearance 18-year-old pie bread J 〇 Creampie to Miss Refre

  • amateur uncensoredfc2
    • 2021-06-05
    110 min

    [AWD-126]My Mom's Nasty 50-something Friend - Rie Takeuchi

  • rie takeuchi censoredbig titsmature womanAWDrubysusumu yanokuchinext doorAWD-126AWD126awd00126
    • 2021-06-06
    118 min

    300MIUM-719 [Face, gesture, body shape … everything is erotic cute] Looks Super idol class horse meat shop part-time job girl is rented as her! Completely REC the whole story that was spoiled up to the originally prohibited erotic acts by persua

  • amateur censoredcreampieamateurmiummium-719mium719300mium-719
    • 2021-06-08
    189 min

    [KIRE-046]Super Sensitive Body That Catches Fire During Sex Real Life Cafe Worker Hinano Okada 27 Years Old Porn Debut

  • hinano okada censoredsingle workKIREsod createdainanabeauty kirei sodKIRE-046KIRE0461kire00046
    • 2021-06-12
    141 min

    [USAG-031]The Sisterly Type. Hikaru (19) Tanned Gal / Hard Thrusting / Super Sweet / Shaved Pussy / Hot Ass / Creampie Sex / 3 Full Fucks / Pov / Three-Some / You'd Never Guess How Slutty She Is

  • censoredUSAGrabbit daydreamersUSAG-031USAG031usag00031
    • 2021-06-19
    69 min

    476MLA-040 Gonzo Hot Spring Gonzo 3rd Round ☆ Fair-skinned busty cafe clerk goes crazy with her boyfriend’s Ji Po sweet copulation! !!

  • amateur censoredbig titsamateurmlamla-040mla040476mla-040
    • 2021-07-06
    86 min

    493NAEN-076 Raw! ？？ Matching app girls ○ students! ？？ Stir a young hole with a big cock and make a demon squid & mass cum shot ring Nico

  • amateur censoredamateurbeautiful girlnaennaen-076naen076493naen-076
    • 2021-07-30
    168 min

    [PRED-329]W Exclusive Lascivious Woman Special: My Female Bosses Were So Horny On A Company Trip That They Begged Me To Fuck Them Non-stop... Yuki Takeuchi, Mami Sakurai

  • yuki takeuchi mami sakurai censoredcreampieslutPREDpremiumzampaelegancePRED-329PRED329pred00329
    • 2021-08-04
    94 min

    300MIUM-732 Megumi G Cup + ASMR [If You Have A Good Voice, You Should Have A Good Chewing Sound？ !! Amateur Girl Hell Edition That Pushes Unreasonableness During Work And Spree.

  • amateur censoredbig titsamateurmiummium-732mium732300mium-732
    • 2021-08-05
    40 min

    H0930 ki210805 Kaori Asada 46years old

  • amateur uncensoredh0930
    • 2021-08-13
    47 min

    FC2PPV 2008722 [5P Orgy & Mental Control Training] I Am Pleased With The Fresh Cock Caught In The Park. The Spirit Of Gari Tsutomu Who Enjoys Vaginal Cum Shot Orgy With Excitement Is Pushed Down To The Limit And Knocked Down To The Bottom Of The D

  • amateur uncensoredfc2
    • 2021-08-27
    122 min

    [EKW-073]No-Choice Rapid-Fire Ejaculations Through Provocative Dirty Talk! The Teasing Female Pervert Who Milks You Of Your Semen, Ayane Sezaki

  • ayane sezaki censoredcreampieblowjobEKWwaap entertainmentk westcobra waapEKW-073EKW0732ekw00073
    • 2021-08-31
    43 min

    292MY-482 Yoneyama Yuna 2

  • amateur censoredbig titsmarried womanmymy-482my482292my-482
    • 2021-09-03
    158 min

    [SHKD-962]The Woman From The Dating App. With Such A Woman, I"ll Absolutely Have To Fuck Her. Kozue Minami

  • minami kozue censoredsingle workSHKDattackersshi yoru akuSHKD-962SHKD962shkd00962
    • 2021-09-07
    131 min

    [090721_001]セクシー女優スペシャル版 ～ 鈴木さとみ 舞咲みくに～

  • amateur uncensored1pondo
    • 2021-09-14
    34 min

    FC2PPV 2201398 [New Work, Half Price! ] ♀43 Professional Student Mi ◯ -Chan 20 Years Old 1st Time (3p) Blindfolded ◯ A Black Man Cheated In A Bundle And Made An Unauthorized Vaginal Cum Shot! Is The Second Undesired Unfortunate Pregnancy A Half-Baby!

  • amateur uncensoredfc2
    • 2021-09-29
    50 min

    318LADY-385 Miharu

  • amateur censoredbig titsamateurladylady-385lady385318lady-385
    • 2021-10-01
    149 min

    [MIAA-507]My Slutty Stepdaughters Came To Visit And Do Their Mother"s Part While I Was Working Away From Home, Starring Lala Kudo and Rina Takase

  • lara kudo rina takase censoredcreampiebeautiful girlMIAAmoodyztakarase hironoriminna no kikatanMIAA-507MIAA507miaa00507
    • 2021-10-15
    118 min

    [EYAN-177]When This Young Boy Came Back Home To The Country In The Middle Of The Summer ... I Could No Longer Suppress My Lust For His Cock ... She Spent The Greatest Week Of Her Life Without Her Bra On, Her J-Cup Titties Jiggling And Wiggling As She

  • miki shiraishi censoredcreampiebig titsEYANe bodytorendei yamaguchihanazakari no tsumatachiEYAN-177EYAN177eyan00177
    • 2021-10-15
    118 min

    [MIAA-513][Mind-Blowing Pussy Orgasms] This Stepfather Gave His JD Stepdaughter Aphrodisiac-Fueled Piston-Pounding Strokes Into Her Pussy And Filled It With His Semen And Bodily Fluids Sweaty, Spasmic Sex With You, Filled With Squirting Orgasmic Ecst

  • ichika matsumoto censoredcreampiesquirtingMIAAmoodyzhata tairyouminna no kikatanMIAA-513MIAA513miaa00513
    • 2021-10-23
    86 min

    FC2PPV 2365430 Until 10/24 [5980pt → 1980pt] [Face Barre] [Beautiful Girl] Slope-Based Idol Audition Finalist! Premier Version With Complete Recording Of Unreleased Footage!

  • amateur uncensoredfc2
    • 2021-11-12
    117 min

    [BLK-538]Slutty Ball Crash Gals vs Strongest Gals Tag! Halem Active Until Balls Are Dry! Hustle! Mass Orgy!! AIKA Ranka

  • aika ranka censoredslutBLKkira kirakira hosi kira black galBLK-538BLK538blk00538
    • 2021-12-03
    158 min

    [JUNY-053]Discovered A Plain Colleague Is A Call Girl...When Undresssed She Is Care Nurse With Huge Tits Ready For Raw Fuck Implantation Breaking In. Wareo Fujisawa

  • reo fujisawa censoredcreampiebig titsJUNYfitchnikuyokuJUNY-053JUNY053juny00053
    • 2021-12-10
    244 min

    [HUNTB-155]I"m Timid And Can"t Even Say No To My Female Classmate That Wants To Come Over And Watch An AV... Then She Starts Feeling Lewd While Watching The AV And Can"t Stop Feeling Around My Crotch.

  • censoredcreampieschoolgirlHUNTBhunterborubo nakanohhh groupHUNTB-155HUNTB155huntb00155
    • 2021-12-20
    89 min

    [YOZ-389]Negotiation With A Mature Woman

  • sakisui ran yamabuki censoredcreampiemature womanYOZstar paradiseyaozokuYOZ-389YOZ389h-254yoz00389
    • 2021-12-24
    96 min

    406FTHT-034 [Scratch Out Shame Juice Like A Waterfall! Sweaty! Lots Of Juice! Push The Vaginal Cum Shot To The Back! Irresponsible Seeding! ] Sensitive Omako Where Lewd Juice Draws Threads! "Oh, I’m Sorry! I’m Out!" Irama Attack Tha

  • amateur censoredcreampiesquirtingfthtftht-034ftht034406ftht-034
    • 2022-01-07
    120 min

    [SSIS-288]All The Customers Are Lusting After The Wife"s Erotic Body... Saki Okuda, A Part-time Married Woman At The Super Public Bath Of Yasuragi.

  • saki okuda censoredbig titsmarried womanSSISs one number one stylemamezawa mametaros1 no 1 styleSSIS-288SSIS288ssis00288
    • 2022-01-13
    123 min

    [FGAN-055]Mai, A Blooming And Tempting Little Devil - Mai Hanagari

  • flower hunting censoredschoolgirlsingle workFGANfetish eyesFGAN-055FGAN055h-1440fgan00055
    • 2022-01-20
    115 min

    [MTALL-010]SEX Training Camp For Completing A Comic Story In One Night And Two Days, And Performing The Story On A Comedy Stage: UMI Natsukawa

  • natsukawa umi censoredbig titssoloworkMTALLmaterialltaiga kosakaiMTALL-010MTALL010
    • 2022-01-22
    300 min

    [JKSR-528]Mature Women Who Are Unfaithful In The Afternoon - 16 People, 5 Hours

  • censoredmature womanJKSRbig morkalobockeyprink junkyJKSR-528JKSR52857jksr00528
    • 2022-02-10
    136 min

    [PIYO-137]"Hey Stepdad, Can I Bear Your C***dren？" When His Stepdaughter Had Grown To A Harvestable Age, Her Stepfather Inducted Her Distorted Love, And Then Creampie Sex ...

  • censoredcreampiePIYOhyokopiero daPIYO-137PIYO1371piyo00137
    • 2022-02-26
    121 min

    [SCD-207]Landlady Sakura Wears Scanty Yukata. Sakura Tsukujima

  • tsukishima sakura censoredcreampiesingle workSCDrubysaburo waremescoopSCD-207SCD207scd00207
    • 2022-03-12
    55 min

    1Pondo 031222_001 Braless Neighbor In The Morning: Eri Saeki

  • amateur uncensored1pondo
    • 2022-04-02
    120 min

    KSBJ-189 Daydreaming About My Son"s Wife, Who Will Cheat On Him. Mika Kisaragi

  • mika kisaragi censoredcreampiesingle workKSBJksb kikaku emmanuellebito sakuraKSBJ-189KSBJ189ksbj00189
    • 2022-04-02
    139 min

    PKPT-009 Lovey-Dovey Documentary Lively K-Cup Girl Hana Haruna A Proper Flirty All-Day Date

  • haruna hana censoredcreampiesingle workPKPTfuck group and fun friends daydreamersPKPT-009PKPT009pkpt00009
    • 2022-04-14
    480 min

    MTM-023 街角シロウトナンパ！ あなたよりエロい友達(ヤリマン)を紹介して下さい！ 18名8時間 BEST vol.02

  • amateur censoredamateurmtmmtm-023mtm023mtm-023
    • 2022-04-22
    68 min

    259LUXU-1581 Luxury TV 1551 "I Haven’t Had It For About 3 Years …" A Cheerful And Preeminent Style Arasa Beauty Is Worried About Sexlessness With Her Boyfriend And Applies For Av! A Popular Beauty Who Holds Down A Point Where A Man

  • amateur censoredbig titsamateurluxuluxu-1581luxu1581259luxu-1581
    • 2022-04-12
    58 min

    FC2PPV 2794216 First Shot ♥ A Miracle That I Was Able To Get Yui-Chan, An Idol-Class Younger Sister, For ¥! Negotiations Are Settled To The Extent That It Is Too Smooth, And It’S Time To Take A Gonzo! Guttsuri Cowgirl, Back Intense Squirrel, Dem

  • amateur uncensoredfc2
    • 2022-05-07
    139 min

    CEMD-168 Scream! Fainting With Pleasure! Development Of G-Spot! Girl Who Cums Deep Within Her Uterus 3. Miiro Nanasaki

  • nanasaki miiro censoredsingle workCEMDserebu no tomoCEMD-168CEMD168cemd00168



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored