creampie jav high vision censored cowgirl




FC2ADNSQTEATIDSPRDAWDCAWDMIDVMARAEBODLULUNATRNNPJAUKSNGODGMEMAVSAFSDSSAUKGMIAAVENX

2020-10-17
59 min

[101720_01]めがね素人 〜気持ちよすぎてメガネが曇っちゃうよ〜

  • amateur uncensored10musume
    • 2020-10-17
    181 min

    [PPPD-874]Continuous Fire Until My Cock Goes Mad! Titty-Fuck Rejuvenation Massage With Super Tit Technique With Yumi Nagase

  • nanao nakano censoredcreampiebig titsPPPDoppaiPPPD-874PPPD874pppd00874
    • 2020-10-17
    300 min

    [DVDMS-589]Face-Appearance Ban Lifted! Magic Mirror Flights, All 38+ Years Old! Hot Married Ladies Who Don't Feel Their Age, In Their First Public Deep Kiss Vol.07 10 Women Sex Special! French Kissing With Young Guys, They Get Steamed Up For The

  • censoredamateurDVDMSdeep sfunky hasegawathe magic mirrorDVDMS-589DVDMS589dvdms00589
    • 2020-10-22
    115 min

    [HONE-253]When I Looked At My Stepmom's Wet Nipples - Yuriko Mikumo

  • yuriko mikumo censoredcreampiemature womanHONEcenter villagejiro fukagawahona zonoHONE-253HONE253h-086hone00253
    • 2020-10-24
    241 min

    [SGSR-266]Street Corner Amateur Channel - Married Woman Gives Herself To A Younger Guy She Doesn't Even Know For A Creampie On Her Ovulation Day Gorgeous Wife Special 4 Hours

  • censoredcreampieamateurSGSRbig morkaleigyochuushinsengumiSGSR-266SGSR26657sgsr00266
    • 2020-10-25
    71 min

    200GANA-2371 Seriously Nampa, first shot. 1546 Bring the underground idol on the way home from the lesson to the hotel as an interview! Inside story of the idol industry ⇒ Fold it up with an H question and expose your pure white skin to the camera!

  • amateur censoredamateurganagana-2371gana2371200gana-2371
    • 2020-11-07
    44 min

    [lady-356]あん(24)

  • amateur censoredamateurblowjobladylady-356lady356lady-356
    • 2020-11-13
    49 min

    [MICA-032]College Girl With A Slim Waist And Perfect Beautiful Tits That We Picked Up Through Her Secret SNS Account Has Her First Big Dick And Threesome Experience!!

  • censoredamateurblowjobMICAmicaelaMICA-032MICA032h-1346mica00032
    • 2020-11-16
    79 min

    403OBUT-024 Ameri

  • amateur censoredmarried womanamateurobutobut-024obut024403obut-024
    • 2020-11-23
    29 min

    FC2PPV 1581003 Limited [Individual shooting] Prefectural ordinary course ② Delicate runaway girl Gonzo

  • amateur uncensoredfc2
    • 2020-12-11
    195 min

    [BAZX-262]Working Girl Wants To Get Choked. vol. 001

  • censoredcreampieuniformBAZXbazookatodoBAZX-262BAZX262h-1496bazx00262
    • 2020-12-15
    244 min

    [SSHN-018]True Filthy Car Action Nookie, Certified By Lovers Of Shame! 8 SODstars Are Trapped And Unable To Scream With Pleasure As They Cum "I Know It's Wrong, But It Feels So Gooood!" 4 Hours Of Continuous, Sensual Pleasure!

  • mana sakura masami ichikawa censoredcreampiesquirtingSSHNsod createsodSSHN-018SSHN0181sshn00018
    • 2020-12-25
    245 min

    [XRW-961]Domme Slut Teases Male Subs - French Kisses And Handjobs 4 Hours

  • jinguji temple nao naoki kiritani censoredsluthandjobXRWreal worksreal real worksXRW-961XRW961172xrw00961
    • 2020-12-31
    64 min

    336KNB-135 “My husband and wife are good! But I can’t see it as a man … “AV appearance in search of stimulation in ordinary everyday life! The young wife who screams in SEX for the first time in a long time makes her hair unkempt

  • amateur censoredmarried womanamateurknbknb-135knb135336knb-135
    • 2020-12-31
    130 min

    [BBAN-306]Mahiro Ichiki Wants To Get Fucked By Kurea Hasumi

  • mahiro ichiki hasumi claire censoredlesbianbeautiful girlBBANbibianBBAN-306BBAN306bban00306
    • 2021-01-07
    87 min

    HEYZO 2461 Circle Of Sex-holic Pornstars -Jyun Mamiya- – Jyun Mamiya

  • jyun mamiya uncensoredheyzo
    • 2021-01-11
    103 min

    FC2PPV 1636711 [Idol / Student] Gonzo video with Saffle underground idol Y-chan will be released w Fair-skinned fluffy marshmallow body shakes violently with a demon egg piston !! Impact video [Personal shooting / amateur]

  • amateur uncensoredfc2
    • 2021-02-05
    63 min

    [YMDS-017]First Time Amateur Shots Documental: Can't Let An Amateur Of The Highest Class Get Away (Miu, 25)

  • censoredcreampieamateurYMDSmomotaro video publishingasakusa is jiroyoung peachYMDS-017YMDS017ymds00017
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-19
    149 min

    [KTKC-107](She's Only Slept With One Person In Her Life, But Her Titty Fuck Count Is Over 300 - 8000 Loads Blown) Babysitter With Colossal Tits Came To Get Used As A Cum Dumpster By Her Classmate - Submissive Slut Gives Incredible Service - Fumin

  • censoredbig titsamateurKTKCkitixx mousouzokubig titsKTKC-107KTKC107ktkc00107
    • 2021-02-20
    57 min

    10musume 022021_01 Not Wearing Make up Amateur : I put makeup on even I go out for a small errand Sanae Kiuchi

  • amateur uncensored10musume
    • 2021-02-25
    117 min

    [SPRD-1379]A Surrogate Pregnancy Mom - Mirei Fujisaki

  • misaki fujisaki censoredmomsingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1379SPRD137918sprd01379
    • 2021-03-03
    120 min

    [PFES-022]An Evil Pervert I Wanted To Have Sex With This Girl That I Had Always Been Pining For, But My Classmate (This Girl That I Absolutely Hated) Cornered Me Into Having Creampie Sex Over And Over Again, And Then She Dominated Me Like A Slut, And

  • mari rika yu tomita censoredcreampieuniformPFEShon nakajo asagirisummer panties festivalPFES-022PFES022pfes00022
    • 2021-03-05
    241 min

    [HEZ-260]Sex Play With Friends! 3 Girls Do Embarrassing Sex Stuff In Front Of Their Friends! 18 Girls

  • censoredamateurHEZhot entertainmenthotHEZ-260HEZ26059hez00260
    • 2021-03-12
    132 min

    [DTT-074]Married Yoga Instructor With F Cup Breasts And A Nice Ass Ai Hasegawa Porno Debut Horny Yoga Teacher Squirts And Squirms As She's Fucked To The Peaks Of Pleasure!

  • ai hasegawa censoredbig titssquirtingDTTprestigeshimikkikanbiDTT-074DTT074118dtt00074
    • 2021-03-12
    348 min

    [SUPA-576]Tokyo Amateur - Raw Fucking Leaked pictures 3

  • censoredschoolgirlamateurSUPAskyu shirotoSUPA-576SUPA576h-244supa00576
    • 2021-03-15
    197 min

    [PYM-369]An Office Lady Trembles With Orgasmic Pleasure As She Bares All Of Her Lust Cafe Masturbation

  • censoredamateurPYMprimoPYM-369PYM369h-283pym00369
    • 2021-03-27
    240 min

    [BDSR-443]Seducing 20 Wives With Aphrodisiacs And Foreplay And Then Fucking Them!

  • censoredBDSRbig morkaljiro kanekoBDSR-443BDSR44357bdsr00443
    • 2021-04-09
    240 min

    [XRW-995]There's No Doubt, Rider Girls Are Absolutely Erotic! 4 Girls Band Edition These Girls Are Wearing The Unofficial Uniform Of Rock-N-Rollers -- The Motorcycle Riders Outfit, And Having Rhythmic And Creampie Sex

  • scooping suzuka walnut censoredcreampieblowjobXRWreal worksannie nakamurareal real worksXRW-995XRW995xrw00995
    • 2021-04-15
    240 min

    [OKAX-731]S********ls In Uniform Miniskirts Flash Their Panties For Male S*****ts To Get Them Hard - And Get Them Off!

  • mai minamata hinano kanzaka censoredslutOKAXkm produceside dishesOKAX-731OKAX731okax00731
    • 2021-04-17
    193 min

    [JUL-545]Surprise Transfer Madonna Exclusive Kana Yume Hot And Steamy Adult Kisses Dripping With Spit 3 Video Special

  • kana yui censoredmature womansingle workJULmadonnamametaro mamezawaJUL-545JUL545jul00545
    • 2021-04-23
    19 min

    10musume 042321_02 Secret Pussy Collection: Minami Fujisawa

  • amateur uncensored10musume
    • 2021-05-01
    61 min

    [050121_001]M痴女 小川桃果

  • amateur uncensored1pondo
    • 2021-05-07
    119 min

    [IPX-656]"Seems Like You're Rubbing Me Down There... Wanna Try Putting It In？" We Heard This F-Cup Titty Bar Hostess Would Let You (Really) Fuck Her. Close-To-Ear Whispering Hikari Azusa

  • azusa hikari censoredbig titsblowjobIPXidea pocketzaku araidishIPX-656IPX656ipx00656
    • 2021-05-08
    157 min

    [TPIN-001](Continued) I'm Called The Man Stuck In His C***dhood Room... My Step Mom And Step Sister Will Do Whatever I Want

  • censoredbig titsmomTPINchinpoinTPIN-001TPIN001tpin00001
    • 2021-05-21
    92 min

    300NTK-573 Beautiful F Cup Calligrapher’s Calligrapher’s Calligrapher * Nuki! !! This is Yamato Nadeshiko, a big-breasted black-haired maiden who teaches hot-blooded rawness with a hand-picking chin-taking handwriting! !! The gap to blame w

  • fsex censoredcreampiebig titsntkntk-573ntk573300ntk-573
    • 2021-05-23
    65 min

    HEYZO 2531 Amateur Girl With Graffiti On Her Body Gets Orgasm Vol.2 – Mami Sekimoto

  • mami sekimoto uncensoredcreampieheyzo
    • 2021-05-28
    72 min

    300NTK-577 Raw chin raw insertion in the pool of the example with a beautiful girl raw distributor who is too cute! !! The pant voice of Kansai lead that leaks involuntarily with raw piss is evidence of a live reaction! ？？ Of course, the finale is fu

  • amateur censoredcreampieamateurntkntk-577ntk577300ntk-577
    • 2021-06-04
    220 min

    [HUNTB-029]"You Can Do Whatever You Want To Me, But Please Leave My Brother Alone" "Fine, So Long As You Have Sex With Us For Three Days!" Loyal Little Stepsister Secretly Pays Her Stepbrother's Debts.

  • censoredcreampieschoolgirlHUNTBhunterkawajirihhh groupHUNTB-029HUNTB029huntb00029
    • 2021-06-25
    120 min

    [MIAA-462]Wan Shows Off Her Hard And Horny Nipples! Seducing Her Beloved C***dhood Friend With Her Erect Nipples Showing Through Her Shirt With No Bra Wan Horikita

  • horikita wan censoredsingle workMIAAmoodyzgoemoneveryone s porn starMIAA-462MIAA462miaa00462
    • 2021-07-02
    174 min

    [RBK-018]At The End Of A Nasty Revenge Confinement And Breaking In... Kana Morisawa

  • kana morisawa kanako iioka censoredsingle workRBKattackersusubashisuiryupakuRBK-018RBK018rbk00018
    • 2021-07-10
    51 min

    H4610 ori1760 Kaori Kokado 21years old

  • amateur uncensoredh4610
    • 2021-07-10
    47 min

    C0930 ki210710 Reiko Hayami 43years old

  • amateur uncensoredc0930
    • 2021-07-17
    97 min

    [OAE-210]Youth And Short Hair. Iroha Shirazaki.

  • iroha shirasaki censoredsingle workOAEaircontrolOAE-210OAE210oae00210
    • 2021-07-24
    66 min

    Pacopacomama 072421_506 Let me buy the underwear you’re wearing right now! Hiromi Hashimoto

  • amateur uncensoredpacopacomama
    • 2021-08-06
    124 min

    [IPX-711]While My Husband Was Away For The Weekend, I Spent Those 2 Days Having Kissing Sex With My Neighbor, With Whom I Did Everything From Kissing To Adultery Over The Course Of A Year, From Morning Until Night Nanami Misaki

  • nanami misaki censoredsingle workdramaIPXidea pocketdoragon nishikawatissueIPX-711IPX711ipx00711
    • 2021-08-06
    100 min

    277DCV-187 Is It Okay To Send It Home？ Case.181 [Reverse Damage! ？？ ] "I’M The Best Woman, You Know If You Try？ 』 Hurry To Her Home! Exposed？ Noshon？ Outdoor Sex？ Unpredictable Situation! "A Ridiculous College Student" I Met In "

  • amateur censoredbig titssquirtingdcvdcv-187dcv187277dcv-187
    • 2021-09-09
    62 min

    413INST-158 [Celebrity Model] Apo Shooting With Galtalent Dm Off Costume Individual Shooting "Seriously Feeling … !!" Celebrity Who Succumbs To A Big Cock And Cums With White Eyes Completely Fallen Sex

  • amateur censoredcreampieamateurinstinst-158inst158413inst-158
    • 2021-09-10
    119 min

    [ROE-008]"My Beloved Wife Becomes A Woman After S******g With Stepson..." Midlife Lewd Spouse Drama By MONROE!! Kyoko Ichikawa

  • kyoko ichikawa censoredbig titsmature womanROEmadonnasatsugu koyamamonroeROE-008ROE008roe00008
    • 2021-09-24
    163 min

    [JUL-714]I Want To See That Smile Forever. Yu Hironaka, 28, AV DEBUT Smile That Gets Your Heart And Makes You Want To Fuck Her

  • yu hironaka censoredmature womansingle workJULmadonnamamezawa mametarouJUL-714JUL714jul00714
    • 2021-10-01
    150 min

    [MIAA-510]One Day, Our Family Welcomed In A New Member, A Little Stepsister, Who Turned Out To Be A Big Tits Sexual Monster, And Now, Me, My Little Brother, My Dad, And My Grandfather All Got Our Brains Fucked Out By Her. Hotaru Nogi

  • nogi firefly censoredcreampiebig titsMIAAmoodyzrakudaminna no kikatanMIAA-510MIAA510miaa00510
    • 2021-10-05
    121 min

    [LOL-201]Y********l Specialty. The Cutest Beautiful Girl Stays Over For POV Creampie Fucking. Riho Takahashi

  • riho takahashi censoredcreampiebig titsLOLglayzrori senkaLOL-201LOL20112lol00201
    • 2021-11-20
    61 min

    1Pondo 112021_001 The Throbbing: My Girlfriend Loves Giving Me a Head Early in the Morning Remi Fuyutsuki

  • amateur uncensored1pondo
    • 2021-11-25
    122 min

    [DLDSS-035]Sorry, I Want To Break Up... An Obedience "Mistress" Contract With A Boyfriend Who Refuses To Break Up - Suzume Mino

  • suzume mino censoredbig titssingle workDLDSSdahliakei isoiDLDSS-035DLDSS0351dldss00035
    • 2021-12-03
    175 min

    [JUNY-052]I Don"t Even Have To Keep An Eye On K*ds At Work Now That I"m Feeling So Good And Squirting Right Through My Clothes! Day Care Worker Is A Shy Secret Slut With J-cup Tits That Loves Masturbation And Ready To Make Her AV Debut. Riko-

  • censoredcreampieJUNYfitchnikuyokuJUNY-052JUNY052juny00052
    • 2021-12-03
    147 min

    [CAWD-319]"I"m Going To Take Those Nipples Together And Make You Cum! After All, Wouldn"t You Like Both Your Left Nipple And Your Right Nipple To Cum Together？" Mei Satsuki Kana Sasaki

  • satsuki mei natsuna sasaki censoreduniformslutCAWDkawaiimon chanCAWD-319CAWD319cawd00319



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored