creampie jav nasty hard hours more high vision




FC2MIAAKSBJNGODADNFSDSSCAWDGMEMNACRHNDMILKVENXAUKGMIDVIPXJULSDABAUKGAWDWANZSSIS

2020-10-23
240 min

[YTR-148]Hey Hey... Why Is It That When I Fool About With My In-Laws, They Suddenly All Start To Be Nice To Me？

  • toua kotone mari kaga censoredcreampieblowjobYTRnonno directorno labelYTR-148YTR148h-127ytr00148
    • 2020-10-24
    77 min

    300NTK-454 Beautiful Breasts New Wife Kimeseku! !! A beautiful woman who talks about her ideal wedding is filled with aphrodisiacs and her reason collapses! !! An erection rushes into Tokoro who is comforting one person in the toilet with an uncontro

  • amateur censoredcreampiemarried womanntkntk-454ntk454300ntk-454
    • 2020-11-07
    54 min

    [oretd-797]Yuzu

  • amateur censoredcreampieuniformoretdoretd-797oretd797oretd-797
    • 2020-11-09
    61 min

    328HMDN-310 [Individual] Saddle a 40-year-old bride of a tall slender boss. A married woman who becomes a captive of a younger meat stick and cums while convulsing

  • amateur censoredcreampiemarried womanhmdnhmdn-310hmdn310328hmdn-310
    • 2020-11-14
    48 min

    FC2PPV 1570167 ☆ The third in the brewing series! ☆ This is the end ♥ Phantom 19-year-old Mahiro and the last vaginal cum shot SEX ♥ [With benefits]

  • amateur uncensoredfc2
    • 2020-11-27
    239 min

    [MCSO-005]Members Only Soapland Brothel For Tanned Sluts - Lotion-Slathered Creampie Sex Best Collection 4 Hours

  • censoredMCSOmercurypremier dreamMCSO-005MCSO005h-1133mcso00005
    • 2020-11-27
    252 min

    [ENKI-031]This 173cm-Tall Neat And Clean, Quiet Little Bunny Is Actually A Genuine Maso Sexual Monster Who Likes To Frequent Happening Bars!!! She Wants To Get Fucked So Badly, This Cum Bucket Likes It Rough And To Get Her Womb Pumped Full Of Cum Har

  • haruka censoredcreampiedeepthroatENKItoxic bacchanalENKI-031ENKI031h-1406enki00031
    • 2020-11-28
    58 min

    H4610 ki201129 Eri Sagawa 30years old

  • amateur uncensoredh4610
    • 2020-12-01
    75 min

    465ANT-009 Sakura

  • amateur censoredbig titsamateurantant-009ant009ant-009
    • 2020-12-04
    50 min

    [TOTTE-011]Aya At 30 Her 4th Year Of Marriage

  • censoredcreampiebig titsTOTTEsadistic villagemagic mirror sadistic villageTOTTE-011TOTTE0111totte00011
    • 2020-12-08
    82 min

    300NTK-469 Visit the hospital to find out what the cause and effect of 170cm beauty G milk OL is! !! The iron plate that I was born with is a raw spit! !! Even a dirty metamorphosis practitioner forgets the preciousness of loving beautiful limbs! !!

  • amateur censoredbig titsamateurntkntk-469ntk469300ntk-469
    • 2020-12-11
    40 min

    [CLO-107]Female Doctor Made A Target: Keiko Keiko Koguchida

  • keiko oguchida censoredCLOchobitchchovicCLO-107CLO107h-1435clo00107
    • 2020-12-21
    126 min

    [KSAT-028]New S*****t! College Girl Aoi With H-Cup Tits Undergoes Magic Potion Creampie Sex Training

  • censoredcreampiebig titsKSATstrong woman s table daydream tribesix mantable of a strong womanKSAT-028KSAT028ksat00028
    • 2020-12-24
    158 min

    [SVDVD-833]Wanted: Amateur Young Wives To Take The Machine Vibrator Challenge! After They Get Their Pussies Nice And Stimulated By The Sensual Massage Machine, If They Can Avoid Squirting Until The End, Even After Receiving High-Speed Piston-Pounding

  • censoredcreampiesquirtingSVDVDsadistic villagesushi yokuboSVDVD-833SVDVD8331svdvd00833
    • 2020-12-27
    240 min

    [MCSO-006]The Best Big Asses! Cumming While Being Piston Fucked Hard As Her Asshole Twitches

  • censoredMCSOmercurypremier dreamMCSO-006MCSO006h-1133mcso00006
    • 2021-01-08
    149 min

    [ABW-045]Ako Shiraishi Will Serve You Good Because She's A Super Newest Beauty Salon Addict 51 She'll Satisfy Her Customers' Desires And Provide The Ultimate Refreshment For Their Rock Hard Cocks!!

  • akiko shiraishi censoredcosplaysingle workABWprestigecharlie nakataabsolutely wonderfulABW-045ABW045118abw00045
    • 2021-01-08
    162 min

    [MIST-323]Hit That Shit On Her Danger Day! You Can Have Babymaking Sex At This Soapland 26 Mr. Michiru 5th Year Anniversary Exclusive Actress Audition: Judging The Acting Category Saryu Usui Shoko Akase Mizuki Yayoi

  • sakisui naoko akase censoredbig titsbeautiful girlMISTmr michirusaitaMIST-323MIST3231mist00323
    • 2021-01-21
    66 min

    H4610 ki210121 Hitomi Egawa 28years old

  • amateur uncensoredh4610
    • 2021-01-27
    90 min

    435MFC-075 [Gonzo to try] Two vaginal cum shots to a pure innocent young lady JD with little experience! ★ Fukurina / 18 years old / A transparent orthodox beauty female college student

  • amateur censoredcreampieamateurmfcmfc-075mfc075435mfc-075
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-13
    64 min

    H0930 ki210213 Gold Pack 20years old

  • amateur uncensoredh0930
    • 2021-02-20
    98 min

    240TOKYO-416 Tomoka

  • amateur censoredcreampiebig titstokyotokyo-416tokyo416240tokyo-416
    • 2021-02-28
    119 min

    [XVSR-581]Love For A C***dhood Friend - Stealing Her From Her Fiance And Having Creampie SEX - Mao Kurata

  • kurata mao censoredcreampiebig titsXVSRmax ak c takedacalenXVSR-581XVSR581xvsr00581
    • 2021-03-26
    54 min

    FC2PPV 1742624 [* White eyes attention *] 5P orgy ★ Ai Yak ★ A female college student who trembles with a lively face while peeling white eyes with Gangimari is too erotic! Super penis and muscular man gorilla SEX are dangerous. [Very ejaculated]

  • amateur uncensoredfc2
    • 2021-04-24
    34 min

    FC2PPV 1784966 [Individual shooting 36] Prefectural K ③ Active model Shaved ⑰ After midnight exposure wandering, vaginal cum shot in the men’s toilet

  • amateur uncensoredfc2
    • 2021-04-28
    64 min

    FC2PPV 1792687 * Limited to this week 6000⇒3980pt ★ First shot premiere ☆ Miracle! Glamorous G Cup Big Breasts Lust Married Woman ♥ Yurie 32 Years Old ☆ This Body Is Too Erotic ♥ Lustful Pussy Floods Man Juice ♥ Raw Saddle Creampie With Other Sticks

  • amateur uncensoredfc2
    • 2021-05-15
    61 min

    481SACZ-026 Setsuko 2

  • amateur censoredamateurmature womansaczsacz-026sacz026481sacz-026
    • 2021-06-01
    53 min

    FC2PPV 1847794 TKBZ ＃ 012 ☆ Worked at a famous bookstore in Tokyo ☆ Shortcut black hair beauty (26) Hairless woman on top posture without rubber while showing off this vaginal cum shot as it is

  • amateur uncensoredfc2
    • 2021-06-08
    64 min

    Caribbeancom 060821-001 I feel good at here -Exploring the erogenous zone and cum creampie sex- Maki Kozue

  • maki kozue uncensoredcreampiecaribbeancom
    • 2021-06-11

    FC2PPV 1863908 Limited time [Uncensored] Private sex video after shooting a petite and busty photo model

  • amateur uncensoredfc2
    • 2021-06-14
    63 min

    491TKWA-004 Yui

  • amateur censoredcreampieamateurtkwatkwa-004tkwa004491tkwa-004
    • 2021-06-27
    125 min

    [HJO-002]潮吹き乳妻の交尾 椎名真帆

  • nishina momoka censoredbig titssingle workHJOprestigehatsujoHJO-002HJO002118hjo00002
    • 2021-07-02
    105 min

    [ADN-331]A Married Woman Who Gets Creampied Every Day By An Older Man Living In A Disgusting Room. Minami Hatsukawa

  • hatsukawa minami censoredcreampiesingle workADNattackerssadao sadaokaotona no dramaADN-331ADN331adn00331
    • 2021-07-04
    58 min

    016DHT-0282 That Queen of Hot finally makes a vaginal cum shot debut! Kiara Suzuki 31 years old

  • amateur censoredcreampieamateurdhtdht-0282dht0282016dht-0282
    • 2021-08-13
    82 min

    259LUXU-1459 Luxury Tv 1443 A Beautiful Woman In Charge Of Public Relations Of A Certain Company Who Decided To Appear In AV With Interest In Her Eyes Gets Wet In Front Of The Camera And Gets Disturbed! She Will Serve As If She Loves The Big Cock In

  • amateur censoredamateurluxuluxu-1459luxu1459259luxu-1459
    • 2021-08-26
    122 min

    [FSDSS-272]Big Tit Colleague Fucks Virgin Boy In The Company Dorm Yuko Ono

  • yuko ono censoredbig titsFSDSSfalenomeatfaleno starFSDSS-272FSDSS2721fsdss00272
    • 2021-08-29
    58 min

    FC2PPV 2101721 A Girl Who Was Sleeping At An Internet Cafe. A Girl Who Couldn’t Stand The Leap By Her Father-In-Law And Left Home With Loneliness And Despair. She Licks Her Unfinished Body And Makes A Lot Of Vaginal Cum Shot In Her Immature Puss

  • amateur uncensoredfc2
    • 2021-08-30
    41 min

    229SCUTE-1131 Miku (21) S-Cute A Lewd Girl Who Squirts While Fucking And H

  • amateur censoredbig titssquirtingscutescute-1131scute1131229scute-1131
    • 2021-08-30
    118 min

    [RD-1072]Filthy Sex Drama From The Showa Era Playboy Groom Fucks His Wife"s Mother Former Teacher Plots Sexual Conquest In The House Of His Married Former Schoolmate

  • yuri satsuki yoko yamashita censoredmarried womanblowjobRDatena eizouRD-1072RD1072
    • 2021-09-01
    126 min

    [GVH-286]Breaking In An Honor S*****t The Immoral Acts That Take Place At School During Summer Vacation The Impregnation Summer Seminar Sakura Tsuji

  • sakura tsuji censoredcreampieschoolgirlGVHglory questkimura hajimeGVH-286GVH28613gvh00286
    • 2021-09-04
    144 min

    [SORA-332]"I Came Without My Bra On So That I Can Become An Exhibitionist At Any Time" This Trade School S*****t With H-Cup Soft Breasts Is Walking Around Town, Looking For Sketchy Situations And Letting Her Erotic Shame Run Wild! She"ll

  • amu ohara censoredbig titsslutSORAyama to sorahimurokkuSORA-332SORA332sora00332
    • 2021-09-09
    124 min

    [FSDSS-289]I Had Always Loved My C***dhood Friend, And Now I Found Out That She Had Become The No.1 Prostitute ... I Ordered All Of The Available Options And Had Real Sex With Her, With Unlimited Ejaculations, In A 3-Day Fuck Fest Together Arina Hash

  • there is hashimoto censoredbeautiful girlFSDSSfalenomeatfaleno starFSDSS-289FSDSS2891fsdss00289
    • 2021-09-10
    119 min

    [JUL-702]It"s Been A Year And A Half Since Her Debut ... The Long-Awaited Lifting Of Her Creampie Ban!! After Every Time She Has Babymaking Sex With Her Husband, She"s Been Continuously Creampie Fucked By Her Father-In-Law ... Rena Kodama

  • kodama rena censoredcreampiebig titsJULmadonnarokusaburo mishimaJUL-702JUL702jul00702
    • 2021-09-13
    64 min

    [SHH-022]Don"t Make A Sound Triple Remote Vibrator Teasing Makes Young S********l Squirt

  • censoredsquirtingSHHnatural highitaka smithlin powderSHH-022SHH0221shh00022
    • 2021-09-23
    130 min

    [KIRE-056]女性は休日に何度も膣を突かれて綺麗になるのだ。 社長秘書独身 香椎佳穂 29歳

  • kashii kaho censoredsoloworkdramaKIREsod createyo sukerei kirei sodKIRE-056KIRE056
    • 2021-09-24
    119 min

    [JUL-715]Sticky Creampie Sex - My Unfaithful Copulation With My Husband"s Boss, Where I Let Out Groans

  • anzu komatsu censoredcreampiemature womanJULmadonnamishima rokusaburoJUL-715JUL715jul00715
    • 2021-09-30
    112 min

    420HOI-201 Natsuna (Natsuna Sasaki)

  • amateur censoredbig titssquirtinghoihoi-201hoi201hoi-201
    • 2021-10-06
    136 min

    [GVH-295]Meet The S*****t Council Brats Who Group Fucked Their Hot Teacher And The Sexy PTA Chairwoman Honoka Kimura & Yuri Mizukawa

  • honoka kimura yuri mizukawa censoredbig titsGVHglory questhyonGVH-295GVH295gvh00295
    • 2021-10-19
    77 min

    230OREC-915 Nana (Hayami Nana)

  • amateur censoredcreampieamateurorecorec-915orec915230orec-915
    • 2021-10-30
    240 min

    [YMDD-251]I"ve Never Seen Titties Like These! A Dream-Cum-True J-Cup Titty Newly Grown-Up Babe!! Hana Himesaki Best Hits Collection

  • himesaki hana censoredcreampiebig titsYMDDmomotaro video publishingdr ishikiri bridgeyoung peachYMDD-251YMDD251ymdd00251
    • 2021-11-01
    71 min

    345SIMM-673 [NTR] A Trap Set Up By A Metamorphosis Husband … A Close-Up Nude Shoot Of A Beautiful Wife And A Young Male Model. My Wife Is A Wife And She Releases Love Juice While Being Watched By Her Husband … This Couple, The Best Matching

  • amateur censoredmarried womanamateursimmsimm-673simm673345simm-673
    • 2021-11-20
    40 min

    FC2PPV 2448498 [New Cinema Style] Limited Number! [Uncensored] Adolescent Fcup Beautiful Girl … Creampie In The Busty Tsundere Girl ◯ Student In The Class! !! This Cheeky Girl Student Is So Disturbed …

  • amateur uncensoredfc2
    • 2021-11-25
    187 min

    [NHDTB-604]Massage Parlor Where Tiny Girls Are Tied Up And Made Cum 2

  • censoredsquirtingNHDTBnatural highrafting maeshiroNHDTB-604NHDTB6041nhdtb00604
    • 2021-12-02
    123 min

    [MILK-127]山口葉瑠 引退作品 春まで待てない決意の卒業大乱交

  • yoko yamaguchi censoredcreampiebeautiful girlMILKmilkMILK-127MILK127h-1240milk00127
    • 2021-12-02
    76 min

    413INST-188 [Reading Notice] Infiltrate The Sex Housing Complex Where Married Women And Sex Addicts ♀ Enter! An H-Cup Woman Who Is Crazy About Sexual Desire Is Awkward At The Orgy Party That Is Opened Every Day! All You Can Commit! All-You-Can-Eat Va

  • amateur censoredcreampiebig titsinstinst-188inst188413inst-188
    • 2021-12-03
    120 min

    [MIAA-539]When The Trains Stopped Because Of The Typhoon, He Let His Big Tits Colleague Spend The Night At His Place ... So He Lent Her His Little Sister"s Clothes (Way Too Small) And When He Could No Longer Resist The Sight Of The Bottom Of Her

  • satsuki mei censoredcreampiebig titsMIAAmoodyzakai suiseiminna no kikatanMIAA-539MIAA539miaa00539



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored