creampie javcensored amateur jav housewife




FC2WANZSQTEROYDDTTAPODADNDASDKBIHUNTBHZGDSPRDATIDMIAAHDKAMEYDDASDGVHSTARSNNPJBLK

2020-10-08
53 min

[h0930-ki201008]椎名 真紀 34歳

  • amateur uncensoredh0930
    • 2020-10-09
    244 min

    [MGT-123]Picking Up Amateur Girls On The Street Corner! vol. 92 Convincing Real Beautiful Married Women. 7

  • censoredcreampieamateurMGTprestigemegatraMGT-123MGT123118mgt00123
    • 2020-10-10
    68 min

    300NTK-445 Aphrodisiac Kimeseku NTR without telling the fiancée of a model-class style beauty! !! While saying that there was no such thing …, I inserted raw chin into a mass of service spirit that finished up to the point of getting wet and squ

  • amateur censoredcreampiesquirtingntkntk-445ntk445300ntk-445
    • 2020-10-31
    118 min

    [MIAA-338]Mutual Abstinence 2cm Pull-Out Sex With Two Virgin S*****ts Who Are Saving Themselves

  • hanaoto urara censoredcreampieuniformMIAAmoodyzdoragon nishikawaminna no kikatanMIAA-338MIAA338miaa00338
    • 2020-11-05
    61 min

    336KNB-127 “I want to have gentle, slow, and soothing sex …” A beautiful mature woman with huge breasts! Forget about the pleasures of a long time and start yoga! I will take a gonzo with this married woman from now on. 23 at Kitatoda,

  • amateur censoredbig titsmarried womanknbknb-127knb127336knb-127
    • 2020-11-13
    123 min

    [REAL-749]Sucking Princess - Satori Fujinami

  • satori fujinami censoredblowjobslutREALreal workssuisei akaireal real worksREAL-749REAL749172real00749
    • 2020-11-24
    38 min

    FC2PPV 1582075 [Individual] A wife who is called on a holiday and is vaginal cum shot at a hotel

  • amateur uncensoredfc2
    • 2020-11-25
    59 min

    [orec-629]はずきさん 2

  • amateur censoredbig titsamateurorecorec-629orec629orec-629
    • 2020-11-28
    175 min

    [GODR-996]Kinky Wives Club - These Housewives Are Secretly Call Girls On The Side - Married Slut Besties Up For A Three-Way And Unlimited Orgasms

  • censoredslutGODRvipgodGODR-996GODR99678godr00996
    • 2020-11-29
    140 min

    [MRSC-006]"Why Are You Stealing Underwear From An Old Lady Like Me...？" 2 This Married Woman Was Being Neglected By Her Husband, And When She Got Her Panties Stolen, That Flipped Her Horny Switch! 13 Ladies, All In Exclusive, Freshly Filmed F

  • censoredcreampiemarried womanMRSCmrs emmanuelwife s trapmrs faceMRSC-006MRSC006mrsc00006
    • 2020-12-06
    102 min

    [HKD-130]I Became A Captive Of My Step-grandson's Body - Hanae Natori

  • hanae natori censoredcreampiemature womanHKDrubysuke kato 6mama rubyHKD-130HKD130hkd00130
    • 2020-12-06
    41 min

    489IKUIKU-003 Mei (22)

  • amateur censoredcreampiesquirtingikuikuikuiku-003ikuiku003489ikuiku-003
    • 2020-12-12
    55 min

    HEYZO 2416 After 6 -Loving Her Lewd Body- – Rena Hiragi

  • rena hiragi uncensoredheyzo
    • 2020-12-12
    120 min

    [IPIT-013]Destined To Cheat - My Wife Ran Into Her C***dhood Friend Again After 10 Years Apart And They Started Fucking Arisu Nanase

  • alice nanase censoreddramaIPITidea pocketdragon nishikawaaipoke excavation projectIPIT-013IPIT013ipit00013
    • 2020-12-13
    147 min

    [DVAJ-490]"I Like You" A Confession From A Meek-Looking Factory Girl Turns Into A Wild Fuckathon - The Story Of How I Nailed Her Eight Times In A Row Ruka Inaba

  • inaba censoredcreampiebig titsDVAJalice japanbieber gonzoDVAJ-490DVAJ490dvaj00490
    • 2020-12-13
    106 min

    390JNT-012 [Seriously juice-covered SP] SNS picking up a metamorphosis nurse of a body fluid enthusiast who puts an erotic selfie on Lee ● Star! !! A transcendental metamorphosis nurse who plays pee in private! Beautiful big tits & Momojiri are c

  • amateur censoredcreampiesquirtingjntjnt-012jnt012390jnt-012
    • 2020-12-15
    63 min

    SIRO-4363 [First shot] [Pink nipple x Momojiri] [Pure white F cup] A young college student who is shy but curious. If you hit an adult technique that you have never experienced in an inexperienced pure white marshmallow body .. Application amateur, f

  • amateur censoredbig titsamateursirosiro-4363siro4363siro-4363
    • 2021-01-08
    71 min

    [ETQR-187][Daydream POV] Earnest Adultery Sex With Gentle & Submissive Married Woman In Love Hotel Room: Narumi (Fake Name) - Narumi Hirose

  • narumi hirose censoredcreampiemarried womanETQRerotic timeETQR-187ETQR187h-1186etqr00187
    • 2021-01-16
    169 min

    [HUNBL-030]"I Wanna Get Dirty..." Sluts At A Labor Camp To Fuck The Filthy Workers Hard.

  • censoredbukkakeHUNBLhunteraldebaranhhh groupHUNBL-030HUNBL030hunbl00030
    • 2021-01-23
    346 min

    [EIKI-098]Why Is My Wife Doing This... This Super Charming Big Tits Wife Who Supposedly Loves Her Husband Is In The Midst Of Committing NTR And Going Cum Crazy For Illicit Sex 10 Big Tits Wives All Getting Creampie Fucked

  • aika sound of hoshino censoredbig titsmarried womanEIKIbig mocaleikiEIKI-098EIKI09857eiki00098
    • 2021-01-26
    57 min

    H0930 ki210126 Yukie Sakai 26years old

  • amateur uncensoredh0930
    • 2021-01-27
    241 min

    [MEAR-002]Corruption With Toys - Transformed Into A Cum Dumpster

  • censoredMEARmercuryarashiMEAR-002MEAR002h-1133mear00002
    • 2021-02-10
    43 min

    FC2PPV 1679611 [February limited sale] Hime-chan and above are unreasonable! Sorry for being too erotic. Immediately after being hit by a famous instrument, a large amount of vaginal cum shot is made to a pre-ketsu beauty man with fair skin! !! The f

  • amateur uncensoredfc2
    • 2021-02-20
    99 min

    [YSN-540]This Plain Jane Temporary Worker With Big Tits Is Hooked On Cocks Because She's A Meat-Eating Maso Bitch With A Screw Loose, And Loves To Suck Dick So Much That The Entire Stuff Is Scared Shitless Of This Crazy Cunt (LOL) Chinatsu Asamiy

  • chinatsu asamiya censoredcreampiebig titsYSNnonYSN-540YSN540h-127ysn00540
    • 2021-02-23
    57 min

    10musume 022321_01 A woman whose baby-faced and bristle gap is too obscene Shiori Nakayama

  • amateur uncensored10musume
    • 2021-02-26
    54 min

    FC2PPV 1691317 [No x bath SEX] Sex in the bathtub … Deep Throating and mass vaginal cum shot !？ (NO.006 Naughty / First half) “Personal shooting / Gonzo”

  • amateur uncensoredfc2
    • 2021-02-28
    130 min

    [EVIS-339]Outside Nudes: Self Shot Masturbation

  • nagaoka saku kurosaki censoredEVISebisusan mousouzokubyakkoEVIS-339EVIS339evis00339
    • 2021-02-28
    107 min

    [VENX-011]New Exclusive Actress! - Do You Get Excited By Older Women's Panties？ A Stepmom Uses Her Panties To Seduce Her Stepson And D***k Every Drop Of His Cum! - Minami Nagata

  • minami nagata censoredcreampiemature womanVENXvenusmajime kitanofakecest winntersVENX-011VENX011venx00011
    • 2021-03-05
    41 min

    FC2PPV 1713074 [Personal shooting] A slender married woman who accepts other people’s cocks because her husband is unemployed and supports her household budget! [Creampie]

  • amateur uncensoredfc2
    • 2021-03-13
    112 min

    [EKDV-657]Usually She's So Prim And Proper, But Now, To My Surprise, She's Become A Kissing Fiend!？ After Missing The Last Train Home, My Colleague Came For Me, No Questions Asked, That Friday Night ... Miu Narumi

  • narumi miu censoredcreampiesingle workEKDVcrystal eizoharuo miyafujie kissEKDV-657EKDV657ekdv00657
    • 2021-03-13
    168 min

    [MIAA-404]See This Face Pussy Babe's Mouth Bulge When It's Full Of Cock The Anaconda Tongued Woman This Lady Boss Is Breaking In Her Deep Throat With Dick Sucking Glee Yumi Saeki

  • yuka saeki censoredblowjobdeepthroatMIAAmoodyzkogoro kindaichieveryone s porn starMIAA-404MIAA404miaa00404
    • 2021-03-15
    110 min

    300MIUM-694 [Creampie in H cup OL! ] A tall office lady with a lump of aesthetics and a trip to skip! If you peel off the skin of 120 throat big breasts, you’ll have too many dreams and you’ll be out of control! !! Roll up the hustle in the

  • amateur censoredcreampiebig titsmiummium-694mium694300mium-694
    • 2021-03-17
    48 min

    492MERC-284 Ro-Kon bastard aiming for prey in the park

  • amateur censoredcreampieamateurmercmerc-284merc284492merc-284
    • 2021-03-20
    66 min

    FC2PPV 1733673 [Leaked Maru video] I cup big breasts beautiful wife ❤️ Genuine first and last complete appearance NN Gonzo! [* Stopped without notice *]

  • amateur uncensoredfc2
    • 2021-03-30
    134 min

    [KMHRS-041]Her Unblemished Body Marked By 11 Loads Of Cum, Plus The First Creampie G*******g Of Her Life Misuzu Miyamori

  • misuzu miyamori censoredcreampieamateurKMHRSsod createkirinkimihoreKMHRS-041KMHRS0411kmhrs00041
    • 2021-04-06
    62 min

    HEYZO 2494 Sex Heaven -Rubbing Her Soft Boobs- – Ayane Sakurai

  • ayane sakurai uncensoredcreampieheyzo
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    120 min

    [JUL-562]My Mother's Friend Iori Nanase

  • iori nanase censoredbig titsmature womanJULmadonnajyoji kawaiJUL-562JUL562jul00562
    • 2021-05-07
    123 min

    [MIAA-434](Mind-Blowing Vaginal Orgasms) This Stepfather Pumped His New Wife's JD Daughter Full Of Piston-Pumping Aphrodisiac-Laced Cum And Enjoyed Gushers Of Fluid-Splattered Sex And Spasmic, Sweaty, Squirting Orgasms Hana Shirato

  • white peach censoredcreampiesquirtingMIAAmoodyzdragon nishikawaeveryone s porn starMIAA-434MIAA434miaa00434
    • 2021-05-07
    131 min

    [HBAD-583]Big Titty Home Delivery College Girl Anime Otaku And Cosplayer With Huge Tits Loves Older Men! Her Whole Body Is A Sexual Organ That Has Her Cumming Over And Over!

  • censoredbig titscosplayHBADhibinobabeHBAD-583HBAD5831hbad00583
    • 2021-06-14
    74 min

    328HMDN-372 Highest Peak H Cup Big Breasts Wife (27 Years Old) Nasty Cheating Wife Loves Handsome Dick. With a jubu wet raw pussy, let the cock crotch and make the milk fluffy and it is continuous! Massive ejaculation to an unequaled wife who invites

  • amateur censoredcreampiebig titshmdnhmdn-372hmdn372328hmdn-372
    • 2021-07-14
    134 min

    [GVH-262]Bossy Female CEO And Her Horny Stepson Mio Kimijima

  • kimishima mio censoredcreampiebig titsGVHglory questhyonGVH-262GVH26213gvh00262
    • 2021-07-27
    99 min

    [MDVHJ-035]The Indecent Sex Life Of An Older Man Living In A Widow's C***dren's Room - Rieko Hiraoka

  • rieko hiraoka censoredmature womansingle workMDVHJgraffiti japanmovieMDVHJ-035MDVHJ03548mdvhj00035
    • 2021-08-06
    130 min

    [HODV-21597]In A Hell Where A Deep Throat Makes Her Weep, She Wants To Be Choked...Breaking In And Mating With A Beautiful Girl Who Has Black Hair And A Tendency Toward Masochistic Play. Minon Aisu.

  • aisu minon censoredcreampiedeepthroatHODVh m pHODV-21597HODV215975642hodv21597
    • 2021-08-10
    122 min

    [KTRA-319]Obedient Stepsister Gets Creampied, Starring Tsumugi Narita

  • narita tsumugi censoredcreampieuniformKTRAke toraibuk tribeKTRA-319KTRA319h-094ktra00319
    • 2021-09-14
    63 min

    SIRO-4625 [First Shot] [Elegant Appearance] [Frustrated Beautiful Wife] A Sexually Abusive Married Woman Who Gets Excited Just By Being Taken And Gets Her Underwear Wet Appears. A Famous Instrument With Vaginal Pressure Enough To Break The Vibe To Sa

  • amateur censoredmarried womanamateursirosiro-4625siro4625siro-4625
    • 2021-10-01
    220 min

    [WAAA-100]Tsubomi"s First Ever Kabukicho Experience: A Sex Industry Nightlife Report With Tons Of Fucking And Cumming

  • bud censoredcreampieblowjobWAAAwanz factoryWAAA-100WAAA100waaa00100
    • 2021-10-07
    135 min

    [STARS-431]緩急つけた変速フェラから、精子欲しがり追撃フェラで大量射精へ…本能むき出しでしゃぶり続ける卑猥なフェラテク 吉永このみ

  • yoshinaga konomi censoredsoloworkSTARSsod createakai suiseisod starSTARS-431STARS431
    • 2021-10-13
    52 min

    541AKYB-016 Mom (21) While Feeling The I (Love) Of A Petite Beauty, Medium ○ ♪ (Momoka Weather)

  • amateur censoredcreampiebig titsakybakyb-016akyb016541akyb-016
    • 2021-11-11
    166 min

    [NHDTB-600]A Female S*****t Sweating In A Closed Room Who Starts Feeling Horny Even Though She Hates Being Licked

  • censoredsquirtingschoolgirlNHDTBnatural highsymmetry nakataNHDTB-600NHDTB6001nhdtb00600
    • 2021-11-20
    49 min

    10musume 112021_01 BJ In Public Restroom: It’s Sudden, But Screw Your Cock Into My Pussy, Please. Nagisa Miyabi

  • amateur uncensored10musume
    • 2021-12-02
    114 min

    [AARM-038]Best Blowjob Where She Keeps Helmet In Mouth While Ferociously Slurping Rod Like a Tornado.

  • ikuta miku tsukishima sakura censoredblowjobhandjobAARMaroma kikakukadowaki shigeoaromaAARM-038AARM038aarm00038
    • 2021-12-03
    28 min

    FC2PPV 2484896 [Personal Shooting] A 21-Year-Old Former Men’s Beauty Salon Clerk Who Became A Little Adult ①

  • amateur uncensoredfc2
    • 2021-12-10
    161 min

    [DASD-950]I Always Had Great Respect For My Bosses ... But During Our Company Trip, To My Great Surprise, I Got G*******ged By Them All ... And I Got My Throat And P*ssy Furiously Penetrated, Over And Over Again ... Hitomi Hoshiya

  • hitomi hoshitani censoredcreampiebeautiful girlDASDdaskogoro kindaichiDASD-950DASD950dasd00950
    • 2022-01-01
    122 min

    [XVSR-629]Perfect Rearing. Stocking. Confinement. 24 Hours. Ichika Mogami

  • ichibana mogami hana sato censoredsingle workXVSRmax ak c takedacalenXVSR-629XVSR629xvsr00629
    • 2022-01-13
    201 min

    [SW-821]Lewd Education For Older Step-sister. She"s All Grown Up Now With A Curvy Body, And She Gets A Big Lesson From A Hard Dick!

  • censoredbig titssisterSWswitchyocchanswitch switchSW-821SW8211sw00821



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored