creampie javcensored slut dmm exclusive def




FC2CHRVHNDMEYDGVHNATRHDKADTTGMEMCAWDLULUVENUONEZMIDEMILKPREDSSNIVEMAMIAAMVSDNGOD

2020-11-10
124 min

[KTRA-255]Uncle Cums Into His Step-niece's Pussy - Ichika Matsumoto

  • matsumoto ichika censoredcreampiesoloworkKTRAk tribeKTRA-255KTRA255
    • 2020-11-18
    43 min

    FC2PPV 1574094 [Individual shooting, nothing, appearance, god gal beauty conceived w] God style Ecup gal beauty and bet refilled with rich conceived SEX! Echi Echi Fucking & Will serve Blow with a smile w

  • amateur uncensoredfc2
    • 2020-11-18
    51 min

    FC2PPV 1574613 [Active Yoga Instructor] Breaking the Race Queen Glossy Pantyhose (Direct Wearing) and Sliding And Cum Shot In A Slimy Pussy! The costume that clings to the F cup body of the highleg mistress who bites in is the best fetishism!

  • amateur uncensoredfc2
    • 2020-11-25
    70 min

    FC2PPV 1583471 [Complete amateur 95] Mirai 19 years old No. 6, complete appearance, a small beautiful girl squirting a lot with electric masturbation, two consecutive vaginal cum shot! !!

  • amateur uncensoredfc2
    • 2020-12-10
    120 min

    [JRZE-013]First Time Filming My Affair - Nozomi Utagawa

  • nozomi udagawa censoredcreampiemature womanJRZEcenter villagekotaro misatojurakuJRZE-013JRZE013h-086jrze00013
    • 2020-12-11
    28 min

    FC2PPV 1602238 [No] I made a cute junior college student cosplay as a cat and made two big cock men commit

  • amateur uncensoredfc2
    • 2020-12-14
    67 min

    FC2PPV 1606858 [First time limited 1980] Pure girls who worked at the airport take a gonzo because of hardship ❤️ 20-year-old Wakeari beauty ❤️ Insert an old man meat stick into a young pussy with strong vaginal pressure ❤️ Raw vaginal cum shot in th

  • amateur uncensoredfc2
    • 2020-12-15
    137 min

    [KUSE-003]Chan Yota (25) Acme X Sexercise

  • chanyota censoredsingle workKUSEsod createanzothis actress style is amazingKUSE-003KUSE0031kuse00003
    • 2021-01-03
    33 min

    FC2PPV 1630863 [Snow skin / Snow beautiful breasts] 20-year-old JD who both parents lost their jobs and had to expose their beautiful skin to earn school fees. A lascivious body that does not stop because love juice flows out to the extent that it ov

  • amateur uncensoredfc2
    • 2021-01-09
    151 min

    [IPX-603]Airi Kijima Untarnished Sex, For Real "If I Get A Boyfriend For The First Time In 10 Years, This Is The Kind Of Sex I Want To Have" That's How This Idea Started No Script, No Direction... This Is Simply A Private Video Of Her, Fi

  • airi kijima censoredblowjobsingle workIPXidea pocketmichiru arashiyamadishIPX-603IPX603ipx00603
    • 2021-01-09
    240 min

    [HJMO-450]If You Can Remain Cool And Calm, You'll Win 1 Million Yen! While Trying To Hold In Her Pee, She's On The Phone With Her Boyfriend Take The "You Absolutely Must Not Cum" Challenge! While Getting A Sexual Pranks Sensual Check,

  • censoredsquirtinguniformHJMOhajime kikakukannana dainanaHJMO-450HJMO450hjmo00450
    • 2021-01-21
    12 min

    HEYZO 2444 Miyuu’s Amazing Hand Job – Miyuu Usagi

  • miyuu usagi uncensoredhandjobheyzo
    • 2021-01-23
    116 min

    [NNPJ-431](Aphrodisiac x Sex Chems x Amateur Girls 02) Picking Up An Arty Girl Who Happens To Be Naughty - We Slipped Her An Aphrodisiac Which Brought Her Guard Right Down! She Transformed Into A Total Slut Desperate For Dick Who Came Hard For A Crea

  • censoredcreampiebeautiful girlNNPJnanpa japanNNPJ-431NNPJ431nnpj00431
    • 2021-01-23
    181 min

    [CAWD-176]Collecting Endangered Species Of Super Masochist Party Gal vol. 2

  • censoredsquirtingdeepthroatCAWDkawaiiCAWD-176CAWD176cawd00176
    • 2021-01-29
    240 min

    [OKAX-701]Wives Wet With Agony! An Unscrupulous Practicioner's Obscene Mature Woman Erotic Massage - 240 Min.

  • censoredmature womanOKAXk m producedick mandokuokazuOKAX-701OKAX70184okax00701
    • 2021-02-12
    31 min

    [CLO-123]Cleavage Shots ... Her Bulging Big Tits Look So Naughty Underneath Her Clothes Haruka Koide

  • haruka koide censoredbig titsblowjobCLOchobitchchovicCLO-123CLO123h-1435clo00123
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-03-03
    120 min

    [PFES-009]My Very Own Lingerie Model Starting One Night The Hottest Girl In My Company Couldn't Result My Seduction And I've Been Fucking Her Raw Since Yu Shinoda

  • shinoda yu censoredcreampiebig titsPFESpremiumtrendy yamaguchisummer panties festivalPFES-009PFES009pfes00009
    • 2021-03-18
    104 min

    300MIUM-676 [Intelligent JD Nasty Awakening! ] Super-brained W college student awakens to true SEX with a thick Ji ● Ko! Crash into a pure white peach butt! Iki voice MAX of tent tremor! !! Oy! Oy! You can hear it outside! !! There is no doubt that a

  • amateur censoredsquirtingamateurmiummium-676mium676300mium-676
    • 2021-03-26
    98 min

    300MIUM-693 [Geki Mote who hits the maximum sales of 6 million ♪ Active cabaret girl] × [Chi ● Ko who was invited to his home in Erocos is invited to Ma ● Ko and man juice leaks sex! ]: Until morning Hashigo Sake 71 in Shinagawa Station area

  • amateur censoredbig titsamateurmiummium-693mium693300mium-693
    • 2021-03-26
    239 min

    [NASH-479]First Time Shots: Lewd, Beautiful Mature Women - Only Good Women Edition

  • censoredcreampiemature womanNASHnadeshikoNASH-479NASH479h-067nash00479
    • 2021-04-07

    FC2PPV 1757191 Up to 11 [Appearance] Private general course ③ Creampie in big breasts who went on to specialize in voice actors of anime voice

  • amateur uncensoredfc2
    • 2021-04-09
    115 min

    [PARATHD-3151]10 Hot And Steamy Lesbian Videos! Beautiful Girls Learning The Pleasure Of Having Their Pussies Touched By Women

  • censoredamateurlesbianPARATHDparadise tvPARATHD-3151PARATHD3151parathd03151
    • 2021-04-09
    148 min

    [EBOD-815]120 Service: Whether It's Sex Or Her Work, This Curvy I-Cup Gives It Her Best - Busty Clerk At A Burger Shop Riku Serina

  • serina riku censoredbig titssquirtingEBODe bodymichiru arashiyamaEBOD-815EBOD815ebod00815
    • 2021-04-15
    92 min

    [VENX-029]What I've Wanted To Do Since I Became A Father-In-Law - My Son's Bride Loves Porn - Karen Otoha

  • karen otoha censoredcreampiemature womanVENXvenuskaniefakecest winntersVENX-029VENX029venx00029
    • 2021-04-17
    116 min

    [NNPJ-443]I Offered The Bold Babe Who Was Giving Me A Business Trip Massage A Huge Tip And To My Surprise She Was Down To Fuck For It Sarina

  • censoredcreampiebig titsNNPJnanpa japanNNPJ-443NNPJ443nnpj00443
    • 2021-04-24
    110 min

    [VEC-474]Bringing A Beautiful Married Woman Who Works At My Part-time Job Home And Fucking Her Raw Nozomi Mare

  • nozomi nozomi censoredcreampiebig titsVECvenusbingo tamatsukamegami venusVEC-474VEC474vec00474
    • 2021-04-30
    242 min

    [HEZ-283]Picking Up Some Daytime Household Wives: I Will Solve The Sexual Frustrations Of Housewives Coming Home From Doing The Shopping! 15 Shots Of Creampie!!

  • censoredcreampiebig titsHEZhot entertainmenthot premium archiveHEZ-283HEZ28359hez00283
    • 2021-05-02
    140 min

    [PKPD-142]Fucking S*********ls In Black Pantyhose Raw And Cumming On Their Faces Over And Over Rin And Miku

  • ikoma miku kagura rin censoredcreampiePKPDfuck group and fun friends daydreamersPKPD-142PKPD142
    • 2021-05-09
    84 min

    FC2PPV 1808761 Prefectural ② Juniors also leaked-Limited quantity-

  • amateur uncensoredfc2
    • 2021-05-31
    123 min

    241GAREA-518 Ai

  • amateur censoredamateurbeautiful girlgareagarea-518garea518241garea-518
    • 2021-06-20
    119 min

    [OFKU-183]Huge Ass Step-Mom Comes To Tokyo From From Ishikawa Aki Misato Age 50

  • aki misato censoredmature womanmomOFKUstar paradisemom railOFKU-183OFKU183h-254ofku00183
    • 2021-07-29
    59 min

    Pacopacomama 072921_508 This Widow is a Super Freak! Sayo Ogura

  • amateur uncensoredpacopacomama
    • 2021-08-10
    152 min

    [SDDE-651][Extreme Room Lockdown] Harlem Special -Welcome To A Girls" College That"s Just For Me- Neat And Clean Innocent S********l For Wild And Lewd Brainwashing

  • ichika matsumoto nana maeno censoredschoolgirlcosplaySDDEsod createinugami ryousenzSDDE-651SDDE6511sdde00651
    • 2021-08-12
    110 min

    [FGAN-046]My Very Own Panty Shot Doll Luna - Luna Tsukino

  • tsukino luna censoredcosplaysingle workFGANfechi mefetish eyesFGAN-046FGAN046h-1440fgan00046
    • 2021-08-30
    126 min

    [RD-1073]This Crazy Massage Therapist Is Coming CLose To This 50-something Married Woman"s Pubic Area...

  • mitsuyo ikuno keiko itagaki censoredmarried womanblowjobRDatena eizouRD-1073RD1073
    • 2021-09-04
    121 min

    [BADA-021]Female C***dhood Friend With A Super Masochist Wish, Maina Yuri

  • yuuri censoredsingle workBADAbarutanusubashi suidiamondBADA-021BADA021bada00021
    • 2021-09-21
    70 min

    Pacopacomama 092121_535 Slut Teacher Who Is Too Dangerous Reika Ayano

  • amateur uncensoredpacopacomama
    • 2021-09-29
    58 min

    491TKWA-192 H Cup Big Tits J ● And 3P Cum Inside! (Riho Takahashi)

  • amateur censoredcreampiebig titstkwatkwa-192tkwa192491tkwa-192
    • 2021-10-01
    135 min

    [VENX-077]A Stepmom And Her Stepson Start Fucking 2 Seconds After Dad Leaves The House - Akane Soma

  • soma censoredcreampiemature womanVENXvenussaruincest vi nasuVENX-077VENX077venx00077
    • 2021-10-07
    71 min

    [REBD-593]Himari 2 - The South Wind, A Barefoot Angel - Himari Asada

  • himari asada censoredsingle workREBDrebeccataiga kosakaiREBD-593REBD593h-346rebd00593
    • 2021-10-21
    127 min

    [JRZE-081]First Time Filming in Her 60s, Sawako Matsui

  • sawako matsui censoredcreampiemarried womanJRZEcenter villageshibuyajurakuJRZE-081JRZE081h-086jrze00081
    • 2021-10-22
    54 min

    [WFR-018]HYPER FETISH Big Tits Dressed Up Monami Takarada

  • takarada monami censoredbig titsslutWFRwaap entertainmentton katsuwWFR-018WFR0182wfr00018
    • 2021-10-24
    97 min

    SRTY-001 Mina (Kitano Mina)

  • amateur censoredbig titsamateursrtysrty-001srty001srty-001
    • 2021-10-29
    107 min

    [RBK-026]New Slut Police Investigator, No. 8. The Target of Revenge. Miki Maeshima

  • miki maejima censoredbdsmsingle workRBKattackersasabuki yuuryuu bakuRBK-026RBK026rbk00026
    • 2021-10-31
    82 min

    FC2PPV 2390869 Kyou-Chan Is The Most Sexually Lustful, Super-Sensitive, Too Erotic And So Cute, Anyway, The Day When Two People Got Fucked With Raw For A Whole Day / First Raw Vaginal Cum Shot Appeal & First Anal Part 1 [Uncensored] * With Benefit

  • amateur uncensoredfc2
    • 2021-11-05
    35 min

    FC2PPV 2406995 Until Tomorrow! Translated By "# 3-2" Ali Runaway Girl. She Has Convulsions In Agony With Intense Piss In The Back Of Her Vagina At The Age Of 18. Creampie In Love ♡ Both Feelings ♡

  • amateur uncensoredfc2
    • 2021-11-05
    162 min

    [ROE-018]An Incredible Selection! A Good Woman Who Knows How To Please A Man - Miki Yoshii, 46yo - MONROE Exclusive Special

  • good miki ryoko izawa miki yoshii censoredbig titsmature womanROEmadonnamamezawa mametaroumonroeROE-018ROE018roe00018
    • 2021-11-17
    69 min

    FC2PPV 2441352 Hold 3 Times Until Registration! !! Midnight [Don Quixote Musume] I Was Stunned By A Large Number Of Facial Cumshots At A Hotel When I Was Called By An Unknown Elderly Person …

  • amateur uncensoredfc2
    • 2021-12-07
    72 min

    FC2PPV 2497011 [Chinkomanko Great Battle! ] Challenge From Bitch! Yarisa ♀ Corps Vs Individual Shooting Gonzo’S Big Orgy Sp ★ Drinking Raw Squirrel Cum Shot Super Heaven ♥ Chinpo Addiction Height 170 Over Busty Beauty Miporin (24) [cen]

  • amateur uncensoredfc2
    • 2021-12-16
    70 min

    [REBD-610]Minami 5 Hah! Final!! Minami Hatsukawa

  • hatsukawa minami censoredsingle workREBDrebeccatakuya takahashiREBD-610REBD610h-346rebd00610
    • 2021-12-25
    58 min

    [122521-001]Power harassment female director who dabbles with a big macho tough guy

  • mikuro komori uncensoredcreampiehandjobcaribbeancom
    • 2021-12-31
    151 min

    [JUFE-359]I Ordered A Girl From A Delivery Health Call Girl Service That Didn"t Allow Real Fucking, And To My Surprise, My Colleague, A Plain Jane, Quiet Office Worker, Showed Up ... Starting Today, This Girl Is Going To Become One Of My Personal

  • kisaki alice censoredcreampiebig titsJUFEfitchJUFE-359JUFE359jufe00359
    • 2022-01-03
    64 min

    1Pondo 010322_001 The Throbbing: A Woman Devoted To Men Yui Fujisaki

  • amateur uncensored1pondo
    • 2022-01-13
    64 min

    FC2PPV 2587718 [Face Exposure] A Sharp Kawa Toy With Big Princesses And White Skin. She Calls The Hotel And Threatens The Woman Who Dislikes It And Forcibly Has Sex And Vaginal Cum Shot Continuously.

  • amateur uncensoredfc2
    • 2022-02-11
    52 min

    FC2PPV 2660172 [None] [Limited To 100 Pieces 2980 → Off To 1480pt!] That "I Sell My Virginity!" Beauty Is Back For The First Time In About A Year! Two Consecutive Shots Of Mouth And Vaginal Cum Shot! * Review Benefits / High Image Quality Ver

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored