creampie mini system javcensored shaved high vision




FC2FSDSSEBODWANZDASDNATRGMEMLULUSHKDMIDECAWDATIDSSNIHNDAVSAVEMASQTEHZGDONEZNNPJNACR

2020-12-13
154 min

[CESD-952]Her Husband Hasn't Fucked Her In Ten Years - Ryo (46) Is So Horny She Cums Like A Nympho

  • censoredcreampiemature womanCESDceleb no tomoCESD-952CESD952cesd00952
    • 2020-12-17
    202 min

    [HUNBL-026]"I Know You Best, Because After All, I'm Your Big Stepbrother!" She Hated His Guts, But When He Kept On Tweaking Her Nipples, She Found Herself Unable To Resist, And Started Drooling With Cum Crazy Desire, Because There Was Now

  • censoredcreampiesisterHUNBLhuntercognac kaminohhh groupHUNBL-026HUNBL026hunbl00026
    • 2020-12-20
    140 min

    [DASD-787]Fresh Face: The Mysterious Beautiful Girl With Pink Nipples Hinata

  • censoredbeautiful girlDASDdasrokusaburo mishimaDASD-787DASD787dasd00787
    • 2020-12-26
    146 min

    [MIAA-365]I Just Started Dating My Girlfriend, And Now She Got Fucked By My Horny Friend... Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiebeautiful girlMIAAmoodyzhirokoji osakieveryone s porn starMIAA-365MIAA365miaa00365
    • 2021-01-15
    57 min

    444KING-024 Mia-san (30)

  • amateur censoredcreampiebig titskingking-024king024444king-024
    • 2021-01-16
    119 min

    [SSNI-972]She Came So Hard She Pissed Herself! But The Guy Just Kept Railing Her! Her First Ever Pissing Sex Izuna Maki

  • izuna maki censoredsquirtingbeautiful girlSSNIs1 no 1 stylesuisei akaiSSNI-972SSNI972ssni00972
    • 2021-01-21
    41 min

    FC2PPV 1654089 [Limited quantity] Mari-chan, a whip whip surfer gal, has lost communication, so it will be delivered at once including past works. Many purchase benefits

  • amateur uncensoredfc2
    • 2021-01-23
    38 min

    FC2PPV 1656317 Limited to 200 pieces, 1480 PT! [Appearance, uncensored, full-scale fetish, raw squirrel] Thick blowjob & happening during intercrural sex w Nyurutto raw squirrel success w If you look at beautiful big tits, you can immediately liv

  • amateur uncensoredfc2
    • 2021-01-24
    119 min

    [BLOR-161]This Cute Thirty-Something Lady Works At A D**gstore And She Turned Out To Be A Soft And Gentle, Kansai-Dialect-Speaking Lady With Amazing Techniques Who Transformed Into A Serious Slut When I Fucked Her With My Big Cock!

  • censoredBLORbroccoli mousouzokubroccoliBLOR-161BLOR161blor00161
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-21
    147 min

    [CAWD-183]Fingering Her With The Cute Kansai Dialect - Twirl, Twirl - "You Can't Cum Yet!" Stuck In Between Two Kansai Girls, I Had A Reverse Threesome Until My Dick Almost Broke - Nana Maeno, Kokomi Hoshinaka

  • nana maeno kozomi hoshinaka censoredsquirtingbeautiful girlCAWDkawaiiarashiyama michiruCAWD-183CAWD183cawd00183
    • 2021-02-26
    55 min

    383REIW-036 Yuna

  • amateur censoredcreampieamateurreiwreiw-036reiw036383reiw-036
    • 2021-03-05
    243 min

    [YMDD-227]Here Comes The Slut Wagon! Best Selection Vol. 3 ~ Busloads Of Girls Who Love Cock! Immediate Fucking! Incident-Filled Special!

  • shinoda yu aika censoredcreampieYMDDmomotaro video publishinglizyoung peachYMDD-227YMDD227ymdd00227
    • 2021-03-09
    123 min

    [KTRA-279]A Limber-Limbed Slender Little Stepsister Gets Her Shaved Pussy Creampie Fucked Karen Junshin

  • innocent karen censoreduniformbeautiful girlKTRAk tribeKTRA-279KTRA279h-094ktra00279
    • 2021-04-12
    126 min

    [GONE-032]Big Tits Lifesaver Loves Sex! Unstoppable Libido

  • censoredcreampiebig titsGONEmercurysmuGONE-032GONE032h-1133gone00032
    • 2021-04-23
    147 min

    [JUFE-284]She Really Wants To Be Spoiled, But Your Sensitive Busty Stepsister Is Too Shy To Ask - Sweet Dirty Talk Seduction Mei Satsuki

  • satsuki mei censoredbig titssisterJUFEfitchJUFE-284JUFE284jufe00284
    • 2021-04-30
    52 min

    FC2PPV 1795505 * Weekend limited 3980⇒2980pt ★ First 3P ♥ I love Ochinchin! Etsuko-chan, a beautiful erotic girl, 23 years old ☆ Natural bristle pussy ♥ Lust for the first W blowjob ♥ Gachi raw squirrel continuous vaginal cum shot ♥ * With special be

  • amateur uncensoredfc2
    • 2021-05-08
    63 min

    Pacopacomama 050821_473 Mature Beauty Without Makeup: Ryu Enami

  • amateur uncensoredpacopacomama
    • 2021-06-02
    240 min

    [YVG-031]Once This Asshole Opens It Never Closes! Asshole Twitches And Convulses Covered In Juices! Intense Anal Fucking 10 Girls 240 Minutes

  • marie konishi shiratori shiratori censoredYVGglory questYVG-031YVG03113yvg00031
    • 2021-06-05
    59 min

    10musume 060521_01 The School Uniform: I’ve seen a cock for the first time in a long time so I can’t stop my excitement Hiroko Akita

  • amateur uncensored10musume
    • 2021-06-16
    118 min

    [SSIS-098]Shared Room Fucking New Employee And Her Boss Have Adulterous Sex All Night During A Business Trip Mai Shiomi

  • mai shiomi censoredblowjobsingle workSSISs1 no 1 stylebungo maedaSSIS-098SSIS098ssis00098
    • 2021-06-17
    144 min

    [BBTU-014]Writhing Pleasure Bouncing Titty Oil Massage Slow Titty Fucking & Slow Sex Miu Arioka

  • arioka miu censoredbig titsblowjobBBTUdogmatenunmy big titsBBTU-014BBTU014bbtu00014
    • 2021-07-15
    55 min

    481SACZ-050 Hitomi 2

  • amateur censoredamateurbdsmsaczsacz-050sacz050481sacz-050
    • 2021-08-12
    198 min

    [SVDVD-870]Shame! Outdoor Knee Buckling! Had Big Bang Vibrator In Her Pussy For Squirting Climax During Date! 20 Rin Miyazaki

  • miyazaki rin censoredcreampiesquirtingSVDVDsadistic villagetoranosukeshuuchi musumeSVDVD-870SVDVD8701svdvd00870
    • 2021-08-12
    163 min

    [NHDTB-565]Cafe Girl Chain Groping 2, Obedient Employees Succumb To Climax During Work One After Another

  • censoreduniformbeautiful girlNHDTBnatural highrafutin maeshiroNHDTB-565NHDTB5651nhdtb00565
    • 2021-09-03
    118 min

    [MIAA-493]Sneaking Into The DILF"s Bed At Night For Superior Sperm Collection Yumi Saeki

  • yuka saeki censoredcreampieslutMIAAmoodyzhiroaminna no kikatanMIAA-493MIAA493miaa00493
    • 2021-09-25
    260 min

    [MDBK-200]33 Person Group With Glamorous Beautiful Legs In Black Stockings!! Perfect Best, 4 Hours.

  • mizuki hayakawa kurata mao censoredMDBKbazookataro kMDBK-200MDBK200mdbk00200
    • 2021-10-15
    121 min

    [FOCS-026]The Discovery Of A Genius!？ She"s Living Life And Enjoying Every Second LOL Even A Delayed Ejaculator Will Immediately Cum When She Whips Out Her Tongue Techniques And Get You Sensitized To The Max With A Perfect And Explosively Fast Co

  • miku kurusu censoredbig titsblowjobFOCSabc mousou zokufocusFOCS-026FOCS026focs00026
    • 2021-10-22
    135 min

    [SSIS-224]Mixed Body Fluids, Deep Sex: Totally Uncut Special Edition Fua Kaede

  • kaede fua censoredblowjobsingle workSSISs1 no 1 stylemonSSIS-224SSIS224ssis00224
    • 2021-10-24
    49 min

    404DHT-0325 Surprisingly Advanced Anal Aunt Her Ageha？ ？？ Age

  • amateur censoredmarried womanamateurdhtdht-0325dht0325404dht-0325
    • 2021-10-29
    65 min

    383REIW-095 Natsu (Natsu Sano)

  • amateur censoredcreampiesquirtingreiwreiw-095reiw095383reiw-095
    • 2021-11-13
    61 min

    1Pondo 111321_012 Tame Unattainable Girl Hina Hodaka

  • amateur uncensored1pondo
    • 2021-11-26
    104 min

    483SGK-055 [Xmas Creampie Special] [Raw Saddle Creampie Super Super Extension] [Bottomless Miraculous Cuteness] [Not Just Cute Climax Ren] [Squirting Pai Pand M] [Fair White Snow Skin Pink Nipples] Get A Pair Of Early Xmas Gifts Je ~! The Cuteness Th

  • xmasgal censoredcreampiesquirtingsgksgk-055sgk055483sgk-055
    • 2021-12-06
    79 min

    259LUXU-1509 Luxury TV 1492 Adult Cute Thirty Married Woman With Attractive Eyes That Seems To Be Sucked In After Worried About Sexless, AV Shooting! A Rich And Intense Kiss And Piston That Provokes M, A Beautiful Face That Strangles The Neck Turns I

  • amateur censoredbig titsmarried womanluxuluxu-1509luxu1509259luxu-1509
    • 2021-12-06
    34 min

    FC2PPV 2491834 * First Time 3,780pt → 1830pt [Uncensored / Individual Shooting] I’m A Female College Student Who Became Beautiful Like Yang Guifei When I Put On Chinese Clothes. Tokyo Daughter Who Is Utterly Disappointed With Sudden Events

  • amateur uncensoredfc2
    • 2021-12-09
    126 min

    [MEKO-221]"Milf Rentals" Service Returns 09. Asked For A Secret Creampie While Fucking This Lewd And Gentle Mature Woman. Now I Want To Come Back To Her For Even More Amazing Sex.

  • censoredcreampieamateurMEKOjukujo laboMEKO-221MEKO221h-1160meko00221
    • 2021-12-13
    46 min

    541AKYB-046 Miku (23) [Big Breasts] [Creampie] [Continuous Ejaculation] (Miku Maina)

  • amateur censoredcreampiebig titsakybakyb-046akyb046541akyb-046
    • 2021-12-14
    127 min

    [KTRA-356]Papa Torio"s Piping Shaved Pussy Creampie Sex Education Rio Nakamura

  • rio nakamura censoredcreampieblowjobKTRAk tribeKTRA-356KTRA356
    • 2021-12-23
    125 min

    [FSDSS-335]"I Want You To Stroke It The Way I Tell You To, Okay ...？" Arina Hashimoto In A Super Pleasure JOI Edition! Devilish ASMR Cock Assistance To Give You Nookie, Over And Over Again

  • there is hashimoto censoredslutFSDSSfalenomaeda satoshifaleno starFSDSS-335FSDSS3351fsdss00335
    • 2021-12-24
    240 min

    [HUNTB-169]When You Have Creampie Sex With Someone Whom You Should Absolutely Never Fuck, Do You Become More Passionate The More You Fuck？ (You"ve Got A Girlfriend, But You Were Lured To Temptation By This Nurse ... She Has A Boyfriend, But At Th

  • censoredcreampieblowjobHUNTBhunterkawajirihhh groupHUNTB-169HUNTB169huntb00169
    • 2021-12-27
    313 min

    [DGCEDG-003]配信限定版 川原かなえハイパーベスト5時間14分

  • kanae kawahara censoredDGCEDGcelebrity friendsDGCEDG-003DGCEDG003dgcedg00003
    • 2022-01-01
    61 min

    [HEYZO-2687]Non Suzumiya Exploring Every Corner Of A Super Cute Girl!

  • non suzumiya uncensoredcreampiecumshotheyzo
    • 2022-01-06
    142 min

    [FANH-054]Legal Petite S*****t Matoi-chan (18) Erotic Goddess Meets Up Offline For Sex Thrust Into Beautiful Obedient Girl"s Womb And Fill With Cum

  • censoredcreampiesquirtingFANHhamedori.network secondeditionFANH-054FANH054h-1472fanh00054
    • 2022-01-08
    40 min

    C0930 ki220108 Sanae Arai 52years old

  • amateur uncensoredc0930
    • 2022-01-13
    150 min

    [FSDSS-352]The Temp Employees I Looked Down On Find Out That I"m A Cherry Boy, And Then Our Roles Reverse! Reverse Threesome With Thorough Nipple Fondling And Complete Ball Draining For Every Bit Of Cum! Nene Yoshitaka, Momo Honda

  • nine yoshitaka honda peach censoredslutFSDSSfalenofaleno starFSDSS-352FSDSS3521fsdss00352
    • 2022-01-17
    62 min

    543TAXD-007 Rina (Rina Takase)

  • amateur censoredcreampieamateurtaxdtaxd-007taxd007543taxd-007
    • 2022-01-17
    46 min

    324SRTD-0265 Massage Shop Manager Relentless Creampie For Apprentice Rookie Girls

  • amateur censoredcreampiebig titssrtdsrtd-0265srtd0265324srtd-0265
    • 2022-01-29
    139 min

    [YMDS-071]The Day Kaho Kashii Became My Girlfriend: D***king, Kissing, And Sexing Around The House

  • kaho kashii censoredcreampieblowjobYMDSmomotarou eizou shuppanjaku momoYMDS-071YMDS071ymds00071
    • 2022-02-04
    120 min

    [JUL-861]Gorgeous I-cup Wife For A Real NTR Cheating Scenario. "I Wan"t Your Wife To Pretend To Be My Lover..." My Terrible Fate After Lending Out My Beloved Wife For A Dear Friend"s Request... Uno Kanaya

  • kanaya uno censoredbig titsmature womanJULmadonnacaptain orionJUL-861JUL861jul00861
    • 2022-02-05
    124 min

    [ILLE-004]Extreme, Submissive Slut Trained To Show Up Naked Under Her Long Coat Mao Hamasaki

  • hamazaki mao censoredbig titssquirtingILLEillegal daydream tribeusubashisuiILLE-004ILLE004ille00004
    • 2022-02-18
    146 min

    [HMN-120]90,000 Followers! The First Raw Creampie Of a Beautiful Charismatic Instagram Influencer Whose Popularity Is Still Going Up - AMu Kodama

  • amu kodama censoredcreampiebeautiful girlHMNhon nakamametaro mamezawaHMN-120HMN120hmn00120
    • 2022-02-19
    117 min

    [NCYF-015]A Seriously Six-Way Large Orgies Fuck Fest That Will Awaken A Tsundere Princess" True Maso Nature! We"re At A Selfie Session Gathering Featuring A 19-Year Old Beautiful Cosplayer Who Traverses The World Of Underground Idols (Guys Wi

  • censoredcreampiecosplayNCYFall japan amateur photographers union daydream fantasy loversudagawaNCYF-015NCYF015ncyf00015
    • 2022-02-26
    125 min

    390JAC-130 [Big Breasts G Cup Boyne X Massive Squirting X Infinite Climax Raw Saddle 7 Barrage! ] Yeah! Huh! !! !! Is The Ridiculously Strongest Dirty Little Boyne GAL Coming？ ？？ Is It Huge Breasts! ？？ Is It A Big Ass! ？？ My Dick! GAL’s Soaked M

  • ggal censoredcreampiebig titsjacjac-130jac130390jac-130
    • 2022-03-05
    62 min

    494SIKA-143 It’s Lewd Even If It’s A Fire Pot Face! Frustrated Inverted Nipple Gully Small Breasts Beautiful Girl

  • amateur censoredamateurbeautiful girlsikasika-143sika143494sika-143
    • 2022-03-11
    73 min

    380SQB-144 Natsuki (Natsuki Kisaragi)

  • amateur censoredamateursqbsqb-144sqb144380sqb-144
    • 2022-03-20
    56 min

    413INST-219 [Woo ● -Women] Muscle Sharpness 23♀! No Bra No Panties Rumored In The Streets Bring In A Too Cute Uva Woman And Seed Sex! Orgy Gonzo With Everyone

  • amateur censoredcreampieamateurinstinst-219inst219413inst-219



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored