cross dresser def jav javcensored censored




FC2BBANSPRDSHKDMVSDVEMAAVSAMEYDMIAASSISRBDAUKSWANZKSBJAPODONEZROYDPPPDHNDNACRCAWD

2021-01-16
120 min

[MVSD-450]A Fated Dual Affair With The New Girl About To Resign From Work To Get Married - My Last Round Of Passionate, Creampie Sex With My Lover Before I Leave The Office Akari Neo

  • akari neo censoredcreampieslutMVSDm s video groupMVSD-450MVSD450mvsd00450
    • 2021-01-20
    135 min

    [GVH-183]Plump General Hospital: Nene Tanaka/Miina Wakatsuki/Kurumi Tamaki

  • miina wakatsuki tamaki walnut censoredbig titsnurseGVHglory questpoison pillGVH-183GVH18313gvh00183
    • 2021-02-09
    73 min

    261ARA-476 [Geki Kawa Bishoujo] 21 years old [Smile is the best] Erina-chan is here! The reason for her application to work at a hot spring inn is “I’m lonely because I haven’t met, so I want to lick my cock w” SEX seems to be abs

  • amateur censoredamateuraraara-476ara476261ara-476
    • 2021-02-12
    126 min

    [BANK-030]10 Creampies In The Open Air Hot Springs - Cute Obedient S********l With Flat Chest And Pointy Nipples

  • horikita wan censoredmature womansingle workBANKpussy banktake chanBANK-030BANK030h-1495bank00030
    • 2021-02-13
    39 min

    H4610 ki210214 Moe Serizawa 18years old

  • amateur uncensoredh4610
    • 2021-02-17
    72 min

    [sika-031]こうちゃん(24)

  • amateur censoredcreampieamateursikasika-031sika031sika-031
    • 2021-02-20
    131 min

    [COD-003]When She Asked Him, "What Part Of Me Do You Like Best？" He Immediately Answered, "Your Pussy," And Now, Every Morning, She Wakes Up To Cunnilingus In A Pussy-Licking Life Together Mahiro Ichiki

  • mahiro ichiki censoredbeautiful girlsingle workCODdream ticketkogoro kindaichiCOD-003COD00324cod00003
    • 2021-02-22
    141 min

    [GMEM-024]The Insane Shame Research Center Climax Dirty Queen Dirty Frenzy Hell A Lusty Horny Queen Withstands Insane Orgasmic Hell Toko Namiki

  • namiki touko censoredbdsmsingle workGMEMavs collector sbaba za babbyavscollector s goldGMEM-024GMEM024gmem00024
    • 2021-02-22
    62 min

    FC2PPV 1697142 Experienced nurse with 3 boyfriends First shot in life with interest-oriented boyfriend H face. Style. Personality. Reaction. Hugging comfort. Erotic All is just right Nurse-chan And another handjob of rotation is included inside A mas

  • amateur uncensoredfc2
    • 2021-03-12
    27 min

    359TYVM-137 Kaho

  • amateur censoredcreampieamateurtyvmtyvm-137tyvm137tyvm-137
    • 2021-03-18
    166 min

    [AKDL-094]G-Cup Sluts - The Ultimate Handjob Techniques Give Guys Multiple Orgasms! Playfully Teased And Edged With Plenty Of Saliva Until The Guys Themselves Squirt, Then Indulged With Hip-Grinding Cowgirl Sex - 5 Loads!

  • censoredsluthandjobAKDLaquinoriaquinoriaknrAKDL-094AKDL0941akdl00094
    • 2021-03-23
    119 min

    [SHIC-204]Shame POV Video Creampie Sex Between A Stepfather And His Stepdaughter

  • censoredcreampiebeautiful girlSHICadolscence.comSHIC-204SHIC204h-839shic00204
    • 2021-04-06
    46 min

    H4610 ki210406 Azusa Kanda 19years old

  • amateur uncensoredh4610
    • 2021-04-14
    176 min

    [ROYD-052]"If They're Bothering You So Much, Feel Free To Touch Them!" I Couldn't Look Away From My Colossal Tits Private Tutor's Enormous Busty, So She Let Me Have My Fill Of Them Until I Busted My Nut Yukino Nagisa

  • yukino nagi censoredcreampiebig titsROYDroyalcognac kaminohhh groupROYD-052ROYD052royd00052
    • 2021-04-17
    236 min

    [REXD-358]Tied Up! Interrogated! And Locked Up! Professional Female Spy "If The Lips On Her Face Won't Talk, Maybe We Should Try The Ones Below..."

  • censoredcreampieREXDredmanji groupREXD-358REXD358rexd00358
    • 2021-04-22
    21 min

    HEYZO 2503 Anna’s Amazing Hand Job – Anna Honda

  • anna honda uncensoredblowjobhandjobheyzo
    • 2021-04-24
    158 min

    [LULU-067]My Adorable Girlfriend's Terrifying Stepdad Was Out For The Day, I Spent The Whole Time Nailing Her From Dawn To Dusk - French Kisses And Creampies Wan Horikita

  • horikita wan censoredcreampieschoolgirlLULUlunaticsluminaxLULU-067LULU067lulu00067
    • 2021-04-26
    56 min

    492JCHA-029 There is no reason why JK taken in erotic videos is naive! 3

  • amateur censoreduniformschoolgirljchajcha-029jcha029492jcha-029
    • 2021-05-01
    160 min

    [DVDMS-662]Smoking Hot Airport Security Guard Yuiko (Age 23) Makes Her Porn Debut - And Loses Her Virginity On Camera! A Working Girl's Porn Performance - This Slender, Toned Babe Has Defined Abs - 307 Days Of Passionate SEX

  • censoredamateurDVDMSdeep shikaru kamegashiraDVDMS-662DVDMS662dvdms00662
    • 2021-05-07
    120 min

    [RCTD-399]Daydream Item: Ultimate Evolution Series, "Out Of Eyes" A Tablet That Makes You Disappear

  • hinako mori pure white reina censoredschoolgirlRCTDrockettaro kanbeRCTD-399RCTD3991rctd00399
    • 2021-05-21
    154 min

    [CAWD-222]I'm A Loser Who Can't Do Anything Right At My Job, And My Big Tits Female Colleague Likes To Make Fun Of Me, But Suddenly, To Our Surprise, We Were Booked Into The Same Hotel Room ... I'm A Cherry Boy, But I Went With The Flow A

  • emi fukada himesaki hana censoredcreampiebig titsCAWDkawaiiamazing meatCAWD-222CAWD222cawd00222
    • 2021-05-28
    56 min

    FC2PPV 1841342 * Monthly limited 2980⇒1980pt ★ First shot ☆ Rainy day married woman! A beautiful mom with a child gets a vaginal cum shot with another stick ♥ Sakura’s 23 years old ☆ Electric Maiki ♥ Intense cancer thrusting bicubic faint in ago

  • amateur uncensoredfc2
    • 2021-06-12
    81 min

    300MAAN-663 [Purupuru ♪ Kamijiri x Abnormal Sensitivity x Bouncing Delicate BODY] Kamijiri with erotic recoil! Slow tempo blowjob that slowly and carefully licks! Cho sensitive constitution that makes you feel swaying! Imadoki’s emo beautiful gi

  • amateur censoredcreampieamateurmaanmaan-663maan663300maan-663
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-20
    256 min

    [NSFS-006]My Husband Is Not Enough: Married WOmen Inviting Men - Best Edition

  • momose yuri sumire seto censoredmarried womanmature womanNSFSnagae styletaro fujoNSFS-006NSFS006nsfs00006
    • 2021-07-02
    98 min

    [ADN-327]Forgive Me, Darling... The Pitfalls Of Age-Gap Marriages Natsu Tojo

  • natsu tojo censoredsingle workdramaADNattackersnagira kenzootona no dramaADN-327ADN327adn00327
    • 2021-07-03
    155 min

    [FCDC-133]The Secretary With The Big Ass And Hard Nipples Who's Always Tempting The Staff Turned Out To Be A Filthy Slut Ayane Sezaki

  • ayane sezaki censoredslutsingle workFCDCweekenderFCDC-133FCDC133fcdc00133
    • 2021-07-14
    117 min

    [MVSD-471]Remote Control Cuckoldry: Listening To My Beloved Wife Moan As She Is Taken By Another Man, Starring Michiru Kujo

  • kujo michiru censoredcreampieblowjobMVSDm s video groupbungo maedaMVSD-471MVSD471mvsd00471
    • 2021-07-14
    12 min

    10musume 071421_01 Rich blowjob that desperately moves a cute face Akane Maruyama

  • amateur uncensored10musume
    • 2021-07-18
    54 min

    FC2PPV 1928791 ☆ First Shot ☆ 22-Year-Old Super Beautiful Apparel Clerk ☆ Immediately Vaginal Cum Shot In 10 Minutes After Meeting 2 Consecutive Vaginal Cum Shot [With Benefits]

  • amateur uncensoredfc2
    • 2021-07-25
    48 min

    FC2PPV 1940304 Only 300 [Uncensored] After Vaginal Cum Shot In An In-House Affair Ol, Insert A Toy, Move By Train, Blow In The Toilet, Vaginal Cum Shot Again

  • amateur uncensoredfc2
    • 2021-07-31
    172 min

    [CMV-157]The Shoplifting Female Teacher Is Thrown Into A Hell of Enema Play. Reika Ochiai.

  • reika ochiai censoredanalsingle workCMVcinemagicmarukatsuvixenCMV-157CMV157cmv00157
    • 2021-08-14
    94 min

    [VENX-067]While My Dad Was Away On A Company Vacation, I Spent The Entire Time Fucking My Stepmom, Whom I Had Always Adored, As We Spent Some Time Together In A Creampie Kind-Of Life Narumi Kawabata

  • narumi kawabata censoredcreampiemature womanVENXvenuskitano majimeincest vi nasuVENX-067VENX067venx00067
    • 2021-09-04
    63 min

    FC2PPV 2147281 * Limited Time Special Price & Bonus Distribution [Listed Company De M Secretary Wife] The Woman Who Can Do It Is Compliant On The Bed Shaved Onaho ♡ Sensitive Body Squirting Squirting View View Shrimp Warp Cum! Extreme Personal Sho

  • amateur uncensoredfc2
    • 2021-09-10
    183 min

    [IPX-725]Getting Creampie At School! G-Cup S*****t Gets Creampie Right At School. Momo Saku

  • sakura sky momo censoredcreampiebig titsIPXidea pocketusa pyondishIPX-725IPX725ipx00725
    • 2021-09-20
    99 min

    [VNDS-3374]The Stepmom Gives Sexual Relief To (Her 35-Year-Old Unemployed Stepson), A Middle-Aged Guy Who Still Sleeps In The Same Bedroom He Grew Up In. Yumie Kashihara

  • tomie kashihara censoredcreampiemature womanVNDSstar paradisenext11VNDS-3374VNDS3374h-254vnds03374
    • 2021-09-21
    33 min

    FC2PPV 2231670 Until Today! Appearance! "# 5" A Sense Of Superiority In Sexual Processing With A Real Idol. Cum Inside The Crazy Womb ♡ Unrequited Love ♡

  • amateur uncensoredfc2
    • 2021-10-03
    42 min

    RURA-010 Momi (pseudonym) (Amaha noi)

  • amateur censoredschoolgirlamateurrurarura-010rura010rura-010
    • 2021-10-07
    15 min

    Caribbeancom 100721-001 Pussy Encyclopedia : Nao Fujishima

  • nao fujishima uncensoredcaribbeancom
    • 2021-10-20
    30 min

    279UTSU-519 Mako-San

  • amateur censoredbig titsmarried womanutsuutsu-519utsu519279utsu-519
    • 2021-10-22
    168 min

    [HMN-057]A Fresh Face This Veterinarian Nurse With A Gentle Smile Is Rumored To Be Even Cuter Than The Pets She Treats, And Here She Is, Making Her Creampie Adult Video Debut!! Riona Sakuraba

  • riona sakuraba censoredcreampiebeautiful girlHMNhonnakausapyonHMN-057HMN057hmn00057
    • 2021-11-08
    31 min

    [551MA002-1]個撮睡眠姦記録 vol.7

  • amateur censoredcreampieamateurma002ma002-1ma0021551ma002-1
    • 2021-11-12
    120 min

    [MIMK-098]If You Try To Take Home The Big Tits Beautiful Girl Human Weapon After She"s Served Her Purpose In Battle... Fastest Live-Action Adaptation of Yagino Meekichi"s Adult Empire Masterwork Doujin!

  • censoredcreampiebig titsMIMKmoodyzkubo stylemankitsuMIMK-098MIMK098mimk00098
    • 2021-11-19
    142 min

    [HMN-083]All Episodes Feature Completely Raw Fucking And Orgasmic Awakenings, Totally Uncut Intermingling Pussy Juices, Semen, And Bodily Fluids Raw, Deep And Rich Creampie Sex Hitomi Hoshiya

  • hitomi hoshitani censoredcreampiesingle workHMNhonnakamonHMN-083HMN083hmn00083
    • 2021-11-25
    188 min

    [HAWA-265]She"s Having Sex Behind Her Husband"s Back "The Truth Is, I"ve Never Even Swallowed My Own Husband"s Cum" She"s Over 30 And D***king Down Cum For The First Time A Perverted Maso Wife Who Gets Her P*ssy Wet When H

  • censoreddeepthroatHAWAcosmos eizohawai nagasecosmospictures soft on demandHAWA-265HAWA2651hawa00265
    • 2021-12-04
    62 min

    Pacopacomama 120421_567 Mature Lady Piledriver Position BJ: Noriko Masaki

  • amateur uncensoredpacopacomama
    • 2021-12-08
    45 min

    511SDK-018 [Production Ok] Sex With A High-Class Delivery Health Lady And Raw Vaginal Cum Shot. Too Dense Time Drowning In Libido

  • amateur censoredbig titsamateursdksdk-018sdk018511sdk-018
    • 2021-12-10
    119 min

    [IPX-774]I Hate My Boss So Badly, I Would Rather Die Than Fuck Him, But To My Shock And Horror, During Our Business Trip, We Were Booked Together Into The Same Room At The Hot Spring Resort Inn ... And I Let This Ugly, Horny Old Man Make Me Cum, Over

  • azusa hikari censoredbig titssingle workIPXidea pocketdishIPX-774IPX774ipx00774
    • 2021-12-10
    107 min

    [VENX-098]"Do My Panties Turn You On？" Aunt Who Squeezed Last Drop of Nephew-In-Law"s Sperm WIth Half Removed Panties. Akari Neo

  • akari neo censoredcreampiemature womanVENXvenusmajime kitanofakecest winntersVENX-098VENX098venx00098
    • 2021-12-14
    61 min

    [121421-001]Continuous vaginal cum shots until the girl gets tired

  • nozomi nakase uncensoredcreampiecaribbeancom
    • 2021-12-25
    120 min

    [SNKH-016]Gカップドスケベ女子は黒人さんとヤリたい！明るくて底抜けにセックス好きな娘がデカマラにドハマり 有村のぞみ

  • arimura nozomi censoredbig titsbeautiful girlSNKHsharksnarkhoodSNKH-016SNKH016h-687snkh00016
    • 2022-01-10
    52 min

    ZOCT-050 Mizuki-san (Mei Mitsuki)

  • amateur censoredcreampieamateurzoctzoct-050zoct050zoct-050
    • 2022-01-13
    93 min

    [OKK-036]Asuka Momose Wet And Shiny And Tight A Goddess In A Competitive Swimsuit We Offer You A Cute Lolita Girl In A Competitive Swimsuit For Your Viewing Pleasure! Watch Her Change In Peeping Videos, And Check Out Those Tiny Titties, Big Tits, And

  • momose asuka censoredbeautiful girlsingle workOKKdaddy s private photosgodly swimming raceOKK-036OKK0361okk00036
    • 2022-01-25
    71 min

    FC2PPV 2622147 [Personal Shooting] 18-Year-Old Child-Bearing Too Erotic Young Wife And Sexy Maid Costume Super-Dense Raw Vaginal Cum Shot Copulation !! Married Woman: Yuki (18 Years Old)

  • amateur uncensoredfc2
    • 2022-01-27
    207 min

    [SW-825]Getting Lewd At A Class Reunion After Seeing A Girl That Was My First Love! She"s A Super Horny Married Woman Now With Huge Tits And Offers Panty Shot Temptation. Fucking At Her Work And Home, All On Record To See!

  • censoredbig titsSWswitchyocchanswitch switchSW-825SW8251sw00825
    • 2022-01-27
    145 min

    [FANH-061]Announcer Class High 20s Office Worker Makoto A Neat And Tidy Minato-ku Girl Is A Lascivious Bitch Who Loves Dick.

  • censoredcreampieamateurFANHhamedori.network secondeditionFANH-061FANH061h-1472fanh00061



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored