cuckold ntr high vision jav censored creampie




FC2ROYDNACXMIDEHNDADNMILKJUFEPPPDHUNTBNATRAUKGAVSAAMBISQTEWAAACESDMEYDSHKDFSDSSMVSD

2020-12-11
241 min

[UMSO-353]This Girl Said, "You Can Fuck Me Instead Of You MILF Mama" As She Took Off Her Clothes... As He Looked At Her And Saw How Big She Had Grown, What Was This Horny Stepdaddy To Do!？ vol. 03

  • mihara honoka mizuki sanada censoredbig titsUMSOk m produceumanamiUMSO-353UMSO35384umso00353
    • 2020-12-16
    136 min

    [GVH-169]Big Booty Bride Has Her First Anal Fuck With Her Father-In-Law Right At Home Miyuki Sakura

  • miyuki sakura censoredanalsingle workGVHglory questtorindoru tanakaGVH-169GVH16913gvh00169
    • 2021-01-01
    134 min

    [EKDV-652]Natsu Tojo Makes Males Subs Cum Buckets! These Desperate Guys Plead To Get Off And Natsu Makes Their Dreams Cum True!

  • natsu tojo censoredcreampiesquirtingEKDVcrystal picturekintaro okumae kissEKDV-652EKDV65249ekdv00652
    • 2021-01-01
    121 min

    [CLOT-014]Pantyhose Temptation - Mitsuba Higuchi

  • mitsuha higuchi censoredcreampieblowjobCLOTplanet plusdirector ocloseCLOT-014CLOT014h-237clot00014
    • 2021-01-02
    27 min

    FC2PPV 1628731 Until the 4th [Individual shooting] My husband came home, but he continued to commit with another stick and made me suck at the entrance and was seen by my neighbor and vaginal cum shot with a look of despair.

  • amateur uncensoredfc2
    • 2021-01-15
    86 min

    [YMDS-013]A Delivery Gal! It's A SK**ls Challenge To See How Many Cum Shots She Can Fire Off! Ran Tsukishiro A Death Match To See How Many Cum Shots She Can Ejaculate!

  • ran tsukishiro censoredcreampiehandjobYMDSmomotaro video publishinghimrockyoung peachYMDS-013YMDS013ymds00013
    • 2021-01-15
    122 min

    [ZEX-400]"It Looks Like You've Missed The Last Train Home..." I Have A Girlfriend, But I Went To The Corporate Apartment Of My Devilish Colleague, And She Stood There Before Me, With No Bra Or Panties On, With No Makeup On, And Hit Me Wit

  • abe mikako censoredcreampiebeautiful girlZEXpeters maxZEX-400ZEX400h-720zex00400
    • 2021-01-23
    118 min

    [JUL-449]Guy She Doesn't Like Makes Her Cum So Hard She Could Die... Aoi Nakajo

  • nakagusuku censoredmature womansingle workJULmadonnajo asagiriJUL-449JUL449jul00449
    • 2021-01-31
    58 min

    [orex-239]なな

  • amateur censoredcreampieamateurorexorex-239orex239orex-239
    • 2021-01-31
    36 min

    493PKPD-090 [Leak] Continuous convulsions Iki hell with big breasts and seeding copulation big cock

  • amateur censoredcreampiebig titspkpdpkpd-090pkpd090493pkpd-090
    • 2021-02-16
    128 min

    [MXGS-1171]Can't Stop Climaxing! H-cup Beautiful Girl With Big Tits Gives An Erotic Oil Massage - Rui Miura

  • rui miura censoredbig titsbeautiful girlMXGSmaxingMXGS-1171MXGS1171h-068mxgs01171
    • 2021-02-21
    120 min

    [JUL-479]During Our Business Trip, To My Great, Great, Surprise, I Was Booked Into The Same Business Hotel Room With My Favorite Lady Boss Honoka Kimura

  • honoka kimura censoredmature womansingle workJULmadonnamametaro mamezawaJUL-479JUL479jul00479
    • 2021-03-14
    33 min

    279UTSU-498 Yuyu

  • amateur censoredcreampiemarried womanutsuutsu-498utsu498279utsu-498
    • 2021-03-16
    70 min

    FC2PPV 1729387 ★ First shot amateur ☆ Doggy Menhera ♥ Riska’s F cup big breasts erotic body Mayuko-chan 24 years old ☆ H love electric maiki ♥ Gachiyaba rich blowjob ♥ De M temperament sexual desire processing pussy ♥ [Personal shooting] * With

  • amateur uncensoredfc2
    • 2021-03-19
    128 min

    [MKON-048]My Girlfriend Found Out About My NTR Hangup, And So, On My Birthday, Perhaps Thinking That I Liked That Kind Of Thing, She Showed Me A Video Of Her Getting Creampie Fucked By Some Strange Old Man Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiesingle workMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-048MKON048mkon00048
    • 2021-03-20
    116 min

    [OFKU-176]How Do I Have Sex With The Beautiful Married Woman With Hot Legs Who Lives In The Same Apartment Complex As Me And Is Always Emitting Pheremones？ Yuri Tadokoro 38 Years Old

  • yuri tadokoro censoredcreampiemature womanOFKUstar paradisemom railOFKU-176OFKU176h-254ofku00176
    • 2021-03-27
    45 min

    [PSST-025]Slutty Cougar Spotted In Hungary! Wild Blonde MILF Wants Cock - Her Raw Porn Debut! Blowjob-Hungry Mature Babe Wants To Suck Your Dick More Than She Wants Food! Tia Blonde

  • tear blonde censoredamateurPSSTpatzkin amateurbooker tPSST-025PSST025h-1450psst00025
    • 2021-04-24
    161 min

    [TNOZ-004]Titty From Colossal 40" Knockers - Cosplayer, Age 19, Big Tits (5-Some Orgy, 11 Loads) Nipple Orgasms And Deep Throat Face Fucking, Creampie Sex, Screaming Orgasms, Breaking In A Slut Endlessly...

  • censoredbig titscosplayTNOZall japan amateur photographers union daspit uncle 2 all japan kameko cooperatiTNOZ-004TNOZ004tnoz00004
    • 2021-05-08
    144 min

    [REAL-768]Impregnating And Cumming Inside S********ls 20 Times Mitsuki Nagisa

  • scooping censoredcreampieschoolgirlREALk m producetorendei yamaguchireal real worksREAL-768REAL768real00768
    • 2021-05-27
    49 min

    Pacopacomama 052721_482 Tattoo housekeeper will give you anything Kasumi Saito

  • amateur uncensoredpacopacomama
    • 2021-06-17
    148 min

    [LZDQ-023]Former Local TV Station Female Newscaster & Young Idol Collaboration First Time Lesbians Number Of Orgasms Challenge

  • narita tsumugi elena takeda censoredlesbianbeautiful girlLZDQlesreheavy smoky ishiirezure documentLZDQ-023LZDQ023lzdq00023
    • 2021-06-24
    151 min

    [HAWA-251]Presenting The Sexiest Highest Recommended Housewife Among My Fuck Buddies.

  • censoredcreampieamateurHAWAkosumosu eizoucosmospictures soft on demandHAWA-251HAWA2511hawa00251
    • 2021-06-26
    57 min

    FC2PPV 1889535 [Personal shooting] Kure is 18 years old with beautiful legs and big tits and vaginal cum shot in a convulsive pussy. [Mountain shooting]

  • amateur uncensoredfc2
    • 2021-06-26
    119 min

    [VEO-044]Authentic Amateur Porn Debut! Real Life Piano Teacher Goes Crazy Shaking Around Her Huge Bouncy G-Cup Tits Ayaka Morimoto

  • ayaka morimoto censoredcreampiebig titsVEOvenuspeterbornVEO-044VEO044veo00044
    • 2021-07-05
    72 min

    [mgbj-001]かよ(26)

  • amateur censoredamateurblowjobmgbjmgbj-001mgbj001mgbj-001
    • 2021-07-08
    155 min

    [CHN-204]新・絶対的美少女、お貸しします。 104 美ノ嶋めぐり(AV女優)19歳。 【MGSだけのおまけ映像付き 15分】

  • amateur censoredamateurchnchn-204chn204chn-204
    • 2021-07-09
    29 min

    FC2PPV 1913146 Hana-chan! A student virgin who has never done more than a kiss! Virgin guidance by an older sister with cum

  • amateur uncensoredfc2
    • 2021-07-24
    240 min

    [MCSR-445]Super Lewd! These Old Women With Their Huge Asses - 10 People, 4 Hours

  • kaoru shimazu michiko uchihara censoredmarried womanmature womanMCSRbig mocalsaburo kamegashimamuscatMCSR-445MCSR44557mcsr00445
    • 2021-07-30
    138 min

    [BF-638]Fucking A Sex-Addicted Girl I Met On A Dating App Until The Box Of Condoms Is Empty. Riho Fujimori

  • riho fujimori censoredcreampiebig titsBFbefreerokuyonBF-638BF638bf00638
    • 2021-07-30
    105 min

    [ADN-332]Marriage Blues. The Night I Creampied A Coworker Who Just Received A Marriage Proposal. Mahiro Ichiki

  • mahiro ichiki censoredsingle workdramaADNattackerskazumaotona no dramaADN-332ADN332adn00332
    • 2021-08-07
    127 min

    [USAG-035]Maki-chan (20) Dark-Gal /Big Tits/ Huge Ass/ Piling Cowgirl/ Facial / Creampie/ 3 Real Sex/ 3P

  • censoredbig titsUSAGusagi mousozokuUSAG-035USAG035usag00035
    • 2021-08-14
    120 min

    [AQSH-075]The Colossal Tits Wife That Gets Addicted To The Traveling Masseur"s Filthy Technique And Calls Him Over And Over Again To Beg For His Cum. Rio Ohara

  • osamu osamu censoredcreampiesingle workAQSHaqua mall heroaqua mallAQSH-075AQSH075aqsh00075
    • 2021-08-18
    124 min

    [GVH-280]Son-In-Law Sets His Sights On Mother-In-Law"s Slutty Big Tits Mako Oda

  • oda mako censoredcreampiebig titsGVHglory questtakahashi chitsujiGVH-280GVH28013gvh00280
    • 2021-08-20
    118 min

    [NNPJ-466]I Take Home A Desperate Gal Whose Date Canceled On Her..."I Just Want To Forget About That Idiot!" We Fuck Until Morning And I Luckily Get To Creampie Her Hina

  • censoredcreampieNNPJnampa japanNNPJ-466NNPJ466nnpj00466
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-10-02
    160 min

    [LULU-099]Wife With A Big Ass Doesn"t Realize Her See-thru Slip-on Is Getting A Big Dick Hard. A Quickie Leads To Non-stop Horny Fucking And Pounding With Plenty Of Creampie Loads. Sumire Kurokawa

  • sumire kurokawa censoredcreampiesingle workLULUlunaticsruminakkusuLULU-099LULU099lulu00099
    • 2021-10-26
    52 min

    FC2PPV 2373744 [Limited] Model-Class Ss Beautiful Girl! I Was Completely Taken By The Ball.

  • amateur uncensoredfc2
    • 2021-10-30
    136 min

    [NKD-283]Wet Insemination S*****t Guidance

  • censoredschoolgirlNKDnakashima kougyouNKD-283NKD283nkd00283
    • 2021-11-04
    60 min

    Pacopacomama 110421_554 No Good Leaks! Kaori Buki

  • amateur uncensoredpacopacomama
    • 2021-11-10
    82 min

    259LUXU-1486 Luxury TV 1481 For The First Time, A Beautiful Woman With A Career As A Former Female Doctor And A Current Adult Anime Voice Actor With Shining Intelligence! Her Adorable Looks, Tickling Voice, And Bewitching Glamorous Body …! Unlea

  • amateur censoredbig titsamateurluxuluxu-1486luxu1486259luxu-1486
    • 2021-11-11
    34 min

    FC2PPV 2422000 [Personal Shooting] Licking The Gravure Girl In The Weekly Manga Magazine [Caution For Withdrawal] [cen]

  • amateur uncensoredfc2
    • 2021-11-20
    108 min

    [BAB-036]First Time Shots. Signs of a Shyness Gap. Miyu Ouka

  • miyu sakuraka censoredblowjobsingle workBABbabylon daydreamersBAB-036BAB036bab00036
    • 2021-12-15
    75 min

    FC2PPV 2518482 [Personal Shooting / Set Sale] My Wife, Who Has A 33-Year-Old Child, Couldn’t Stand It And Put In Raw Cheeks …

  • amateur uncensoredfc2
    • 2021-12-24
    119 min

    [HMN-097]What If... My Beloved Girlfriend Is An AV Actress... The Day I Saw An AV Where The Girl Looks Just Like My Girlfriend And Gets Fucked By A Male AV Actor For A Creampie Load. Kasumi Tsukino

  • kasumi tsukino censoredcreampiebig titsHMNhon nakamametaro mamezawaHMN-097HMN097hmn00097
    • 2022-01-04
    86 min

    261ARA-522 [Transcendental Beauty] [Big Tits To Love] Rino-Chan Visits! "If You Feel Comfortable, It Will Be Good For Beauty!" I Want To Have Sex To Keep It Beautiful! !! W [Obscene G Cup] [Nasty Service Tech] With A Tongue That Is Too Erotic

  • amateur censoredbig titsamateuraraara-522ara522261ara-522
    • 2022-01-14
    60 min

    553APLT-011 Nanaho (Nanaho Kase)

  • amateur censoredamateurapltaplt-011aplt011553aplt-011
    • 2022-01-14
    121 min

    [MVSD-495]Hard-Pounding Cuckold"s Revenge - What Would You Do If You Spotted Your Best Friend Nailing The Girl You"ve Had A Crush On Your Whole Life？ Transformed With Rage, You Wait Until He"s Out For 3 Days, And Spend The Whole Time Bang

  • akari neo censoredcreampiesquirtingMVSDm s video groupMVSD-495MVSD495mvsd00495
    • 2022-01-15
    119 min

    [BXX-010]Squeezing Her Neck

  • hamazaki mao asahi drop censoredBXXbermuda mousouzokuphoenix van associatesBXX-010BXX010bxx00010
    • 2022-01-21
    98 min

    [VEC-515]Married Woman Is Betrayed By Her Friend And Fucked By An Awful Disgusting Man! Mio Kimijima

  • kimishima mio censoredcreampiebig titsVECvenuspetermegami venusVEC-515VEC515vec00515
    • 2022-02-14
    67 min

    [SHN-073]Hotel Shame After Saving One Of Her Staff Members, This Big Tits Hotel Manager Was Paid For Her Actions With Fully Nude Bukkake Creampie Sex

  • censoredcreampiebig titsSHNnatural highitaka smith rimpounderspecially selected nachu girlsSHN-073SHN0731shn00073
    • 2022-02-20
    87 min

    [YOZ-390]From Roppongi: The Highest-class Beauty, Only For You!! Business Trip-type Delivery Style Prostitute

  • rumi tadami mio shintani censoredcreampielingerieYOZstar paradiseyaozokuYOZ-390YOZ390h-254yoz00390
    • 2022-02-24
    68 min

    [494SIKA-140]炉利ギャルと中出し3P お風呂場オナニーフェラ

  • amateur censoredcreampieamateursikasika-140sika140494sika-140
    • 2022-02-26
    104 min

    300MAAN-752 [Geki Kawayariman Goddess Advent On The Slopes Of Niigata] Snow Magic Fantasy ♪ Isn’t On The Slopes! In The Open-Air Bath？ !! Get Up On The Futon! ？？ The Excitement Is Max! Tobisio Oma ○ This Is Too Famous And Immediately Ascended! !

  • amateur censoredcreampiesquirtingmaanmaan-752maan752300maan-752
    • 2022-03-01
    80 min

    451HHH-043 [Hentai That Is Pleased To Be Seen Naked] [170cm Beauty Big Tits] Former Fashion Model Shakes Her Long Limbs And Acrobatic! Sprinkle The Tide And Go! I’m Crazy With My Whole Body! Ma ● Ko With A Clear Face And Overgrown Is Nuruteka! E

  • amateur censoredcreampiebig titshhhhhh-043hhh043451hhh-043
    • 2022-03-14
    40 min

    FC2PPV 2720886 In-Car Affair With A Beautiful Young Wife Who Squirts! Sperm Entwined With The Tongue Is Put Out And The Inside Of The Car Is Covered With Tide With The Tide That Scatters Just By Touching The "Gokkun" Clitoris

  • amateur uncensoredfc2
    • 2022-03-17
    179 min

    [AKDL-175]Did I Really Fuck The Wrong Person After I Getting So Horny!？ This Girl Got Horny From My Cock And Started Thrusting Herself For Huge Climax 3

  • niwa sumire tsukishima flower censoredcreampiebig titsAKDLaquinoriaquinoriaknrAKDL-175AKDL1751akdl00175



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored