cuckold ntr hours more housewife javcensored creampie




FC2ATIDGMEMSSISJULNNPJHMNJUFEPREDSPRDMIDEMILKMVSDAVSAWAAAVENXDASDMARAVEMAKBIHZGD

2020-09-24
198 min

[NHDTB-440]Slobbery, Perverse Kissing 4 This Perverted High S*********l Presses Her Body Against A Middle Aged Man, And Licks Him All Over

  • censoredschoolgirlslutNHDTBnatural highsakurai baniraNHDTB-440NHDTB4401nhdtb00440
    • 2020-09-25
    100 min

    SMUK-034 Nozomi 2

  • amateur censoredschoolgirlamateursmuksmuk-034smuk034smuk-034
    • 2020-09-29
    121 min

    [KIRE-001]Re DEBUT! Akane Soma continued to hornily target cock while getting electric shock transfers!

  • soma censoredblowjobslutKIREsod createk westbeauty kirei sodKIRE-001KIRE0011kire00001
    • 2020-10-04
    122 min

    S-Cute 802_ayu_01 After 7 hours of spear, I couldn’t move with my hollow eyes! / Ayu

  • amateur censoredamateurayuayu-01ayu01802-ayu-01
    • 2020-10-19
    50 min

    [oretd-781]HIMARI

  • amateur censoredcreampieamateuroretdoretd-781oretd781oretd-781
    • 2020-11-04
    299 min

    [HZHB-002]TSUMABANA [60fps] High Image Quality, 5 Hours Ultra HD BEST

  • natsuho imai arisaka miyuki censoredcreampiebig titsHZHBmarried woman garden theaterimageiiHZHB-002HZHB002h-1100hzhb00002
    • 2020-11-07
    52 min

    [oretd-790]うららちゃん

  • amateur censoredcreampieuniformoretdoretd-790oretd790oretd-790
    • 2020-11-13
    58 min

    FC2PPV 1568767 Complete appearance ❤️❤️ Rich cum shot SEX while flirting with an idol class beautiful girl (18) ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2020-11-29
    42 min

    FC2PPV 1588530 [New work until December 6th 1600pt → 1200pt] [First shot] 38-year-old neat and clean Pocha wife and Gonzo! !! The shy wife is also unusually wet ♡ [High image quality]

  • amateur uncensoredfc2
    • 2020-12-05
    63 min

    407KAG-117 It’s a perverted delusion that is humiliated! !! Saddle up an intelligent office lady with a service temperament ww

  • amateur censoredbig titsamateurkagkag-117kag117407kag-117
    • 2020-12-10
    233 min

    [FTHTD-001]Picking Up Girls Traveling Alone Country Girls Always Go Wild In Tokyo Episode 1 Featuring: FALENO TUBE

  • censoredcreampiebig titsFTHTDfalenodavielfalenotubeFTHTD-001FTHTD0011fthtd00001
    • 2020-12-24
    211 min

    [NHDTB-472]S********ls Fingered By Their Naughty Teachers Give In To Pleasure And Let Themselves Get Secretly Fucked To Multiple Orgasms

  • censoredbig titsNHDTBnatural highlemonheart nakajimaNHDTB-472NHDTB4721nhdtb00472
    • 2021-01-01

    FC2PPV 1628417 * Ends in 3 days [Appearance] Prefectural Commerce Department ① Staying in a simple little girl with one experience and vaginal cum shot

  • amateur uncensoredfc2
    • 2021-01-15
    482 min

    [PYM-364]Self Shots: Fainting In Agony While Masturbating Collection: 100 Unequaled Married Women

  • censoredmarried womanPYMprimoPYM-364PYM364h-283pym00364
    • 2021-01-18
    48 min

    IDJS-030 Miki

  • amateur censoredcreampieamateuridjsidjs-030idjs030idjs-030
    • 2021-02-02
    119 min

    FC2PPV 1669671 First shot ❤️ A tall slender student said “Don’t put it inside!” So I made a vaginal cum shot w [Personal shooting]

  • amateur uncensoredfc2
    • 2021-02-06
    120 min

    [JUL-471]My Husband Can't Satisfy Me... Married Slut Needs Her Boss's Huge Cock Riho Fujimori

  • riho fujimori censoredbig titsmature womanJULmadonnakitorune kawaguchiJUL-471JUL471jul00471
    • 2021-02-11
    187 min

    [NHDTB-491]2 Holes Creampie Group Sex Bus

  • censoredanalcreampieNHDTBnatural highjanken kotamaNHDTB-491NHDTB4911nhdtb00491
    • 2021-02-12
    160 min

    [IPX-612]Hot Female Teacher's Tryst With Her S*****t - Passionate Love-Making POV Footage Record Karen Kaede

  • karen kaede censoredblowjobsingle workIPXidea pocketzaku araidishIPX-612IPX612ipx00612
    • 2021-02-15
    205 min

    [PTS-476]Smoking Hot Transsexual - Passionate Lesbian Sex Vol. 7 - High-Class Married Woman Massage Parlor

  • azusa tani sakiya yuki censoredcreampiemarried womanPTSpetersPTS-476PTS476h-021pts00476
    • 2021-02-21
    153 min

    [HND-944]A Fresh Face This Quarter-Japanese College Girl Is Working At A High Class Bathhouse While Attending A Young Ladies' University, And Now She's Making Her Creampie Raw Footage Adult Video Debut Ayumi Manaka

  • ayumi aika censoredcreampiebeautiful girlHNDhon nakamametaro mamezawaHND-944HND944hnd00944
    • 2021-02-23
    72 min

    451HHH-018 [QUEEN of Butt] [Real Married Woman] [Immediately Wet Guchogucho Glittering Ma ● Ko] A hybrid slut actress with a body of M and a heart of S participates in AV to fill sexlessness with her husband. Frustration Ma ● Ko is Reason Collapse wi

  • amateur censoredcreampiemarried womanhhhhhh-018hhh018451hhh-018
    • 2021-02-28
    56 min

    330PER-369 Mako 2

  • amateur censoredcreampiemarried womanperper-369per369330per-369
    • 2021-03-04
    41 min

    FC2PPV 1710869 Complete appearance ❤️ Fair-skinned beauty with big breasts “Because it’s a safe day today …” A large amount of raw vaginal cum shot in the back of the womb Seeding The best metamorphosis video ever ❤️ [Personal sho

  • amateur uncensoredfc2
    • 2021-03-11
    41 min

    FC2PPV 1721029 * None * First shot! !! Big Breasts H Cup ☆ Celebrity Married Woman Marin (25) Living in Minato Ward Finally Debuts Raw Saddle In The Third Year Of Sexless ♡ Luxury Review Benefits Available

  • amateur uncensoredfc2
    • 2021-03-23
    165 min

    FC2PPV 1737461 32: [Individual shooting] Classmate of the metropolitan commercial department, support for girls with big breasts [4K image quality 60fps]

  • amateur uncensoredfc2
    • 2021-04-03
    140 min

    [PKPD-139]A Rubberless Pay-For-Play Sugar Daddy x A Sch**lgirl In Loose Socks In A Half-In/Half-Out Half-Day Of Fucking

  • suzuka walnut is it censoredcreampieuniformPKPDfuck group and fun friends daydreamersPKPD-139PKPD139pkpd00139
    • 2021-04-14
    192 min

    [HUNTA-987]Now I Can Get Laid Any Time, With Anybody I Want... My Sharehouse Is Full Of Busty College Girls And I Can't Concentrate On Studying For Exams...

  • censoredcreampiebig titsHUNTAhuntervolvo nakanohhh groupHUNTA-987HUNTA987hunta00987
    • 2021-04-22
    118 min

    [DLDSS-003]Spectacular! A Shocking Transfer A DAHLIA Exclusive Her Body Is Pumping Out 200 Sexy Pheromones Rin Azuma "I Wanted To Fuck Until I Lost My Mind ..."

  • dongguan censoredbig titssingle workDLDSSdahliatake dDLDSS-003DLDSS0031dldss00003
    • 2021-05-01
    136 min

    [JUL-560]I'm Done With Pretending To Love And Pretending To Be Loved Married Women Starved Of Love And Lust Yu Nagano 27 Years Old Porn Debut

  • yu nagano censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-560JUL560jul00560
    • 2021-05-01
    147 min

    [JUL-568]Neighborhood Camp Cuckholding [Viewer Warning] Cuckholding Video Of Wife Getting Fucked Raw In A Tent Nao Jinguji

  • jinguji temple nao censoredcreampiebig titsJULmadonnajotaro tomiJUL-568JUL568jul00568
    • 2021-05-08
    59 min

    FC2PPV 1807595 [Black 3P x NTR x personal photography] Welcome to the newlyweds! A 22-year-old gal new wife is seldom inserted into the strongest black tag in front of her husband and is taken down and cum shot 4 times in a row! Insert up to the fath

  • amateur uncensoredfc2
    • 2021-05-14
    103 min

    300NTK-563 Celebration! !! Newcomer! !! Black-haired maiden’s temptation F milk! !! The sex appeal is already super new adult class! ？？ Demonstrate overwhelming bokki inducing power by making full use of the Echi beauty body in the commemorative

  • amateur censoredcreampiebig titsntkntk-563ntk563300ntk-563
    • 2021-05-21
    84 min

    483SGK-025 [Simple child hidden F big breasts] [Mutchimuchi body that makes you want to hold] [Big Biku sensitive climax] [Spanking shameful de M] Proof that the nerd is the most erotic! A body that makes you want to embrace! Fcup’s hidden big t

  • amateur censoredbig titsamateursgksgk-025sgk025483sgk-025
    • 2021-05-29
    63 min

    C0930 tk0035 Masae Fujisaka 27years old

  • amateur uncensoredc0930
    • 2021-06-04
    172 min

    [JUL-593]365 Days Of Estrus The Bunny Wife With The Strongest Sex Drive In The Animal Kingdom Iori Takahira 30 Years Old Porn Debut

  • high ratio good cage censoredmature womansingle workJULmadonnamametaro mamezawaJUL-593JUL593jul00593
    • 2021-06-10
    210 min

    [ABW-104]神乳Ecupを味わい尽くす性感覚醒3本番 神の造形美！！超絶美乳 美ノ嶋めぐり 【MGSだけのおまけ映像付き 15分】

  • amateur censoredbig titsamateurabwabw-104abw104abw-104
    • 2021-07-01
    120 min

    [NACR-440]My Boss' Wife Looks Like My Own Late Wife - Michiru Kujo

  • kujo michiru censoredcreampiebig titsNACRplanet plussakura ninshichi ku ryuuNACR-440NACR440h-237nacr00440
    • 2021-07-15
    120 min

    [ZEX-406]Miraculous Transparency 2021 REMAKE - 9 Years Since Her First AV Debut Sold 10,000 Copies!! Mikako Abe 27 Years Old

  • abe mikako censoreduniformZEXpeters maxZEX-406ZEX406h-720zex00406
    • 2021-07-18
    77 min

    FC2PPV 1929252 Up To 25 2000 [No] Hairless Slender Masochist Toys. Playing With The Body That Trembles With Fear, Continuous Vaginal Cum Shot.

  • amateur uncensoredfc2
    • 2021-07-26
    68 min

    IDJS-063 Aoi

  • amateur censoredcreampieamateuridjsidjs-063idjs063idjs-063
    • 2021-07-29
    55 min

    FC2PPV 1946160 ☆ First Shot ☆ Complete Appearance ☆ Slender Beautiful Girl With Long Black Hair 20 Years Old ♥ Overflowing Sex Appeal And Immediate Wetness Oma ○ I Was Excited About This And Released A Lot ♪ [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-08-22
    52 min

    413INST-150 2nd Year General Course Cultural Glasses Fujoshi And Uniform Raw Saddle! Too Young Slender Tall Beautiful Girl Cums Continuously With Netorare Dirty Talk Daddy Activity! I Want To Have A Vaginal Cum Shot With An Anime Voice, So I Implante

  • amateur censoredcreampieuniforminstinst-150inst150413inst-150
    • 2021-09-03
    176 min

    [CAWD-272]This Real-Life College Girl Who Works At A Wholesome Massage Parlor Is A Pushover Who Can"t Refuse A Proposition, So She Decided To Give Her Customer A Handjob And Now Here She Is, Making Her Debut And Squeezing Out 8 Cum Shots For You

  • mitsuki okina censoredhandjobsingle workCAWDkawaiimamezawa mametarouCAWD-272CAWD272cawd00272
    • 2021-09-10
    57 min

    ZOCT-025 Maina (Miura Maina)

  • amateur censoredcreampieuniformzoctzoct-025zoct025zoct-025
    • 2021-09-24
    134 min

    [SKMJ-209]*Barely Legal *Absolute No Condoms *A 19-Year Old Exposes Her Lust And Goes On A Hot Spring Resort Vacation *A 4-Fuck Extravaganza

  • censoredcreampieamateurSKMJsekimenjoshikantori wajimasekimen goshiSKMJ-209SKMJ209h-1324skmj00209
    • 2021-10-08
    124 min

    [JUL-732]The Room, A Dress Shirt, And Big Tits - I Spent 3 Days And 2 Nights Committing Adultery With The Married Woman Next Door When She Ran Out Of The House After A Fight With Her Husband - Rinka Tahara

  • rinka tahara censoredcreampiebig titsJULmadonnakubo nawoyukiJUL-732JUL732jul00732
    • 2021-10-15
    62 min

    300NTK-646 [F Cup Beautiful Breasts Echona] [Umauma Beauty Hips] [Suddenly Inserted Pregnancy] Super Special Beauty’s Hurry Straddling Raw Chin Insertion Start! !! The Reason For Being Impatient Is The Runaway Desire For Marriage …! ？？ 2 Co

  • fsexnn censoredcreampiebig titsntkntk-646ntk646300ntk-646
    • 2021-10-15
    165 min

    [DVDMS-726]My Ideal Orgasm Miro Nanasaki After 32 Days Of Abstinence, She Was At Her Limit, And Now She"s Unleashing Her Pent-Up Lust With Some Serious Sex And Cumming Like Crazy 4 Fucks

  • nanasaki miiro censoredsquirtingbeautiful girlDVDMSdeepsbiba gonzoDVDMS-726DVDMS726dvdms00726
    • 2021-10-16
    130 min

    [TIKP-062]A Maso Pervert Whose Brain Is Bugging Out Kanna Hirai

  • shiori hirai censoredcreampiesingle workTIKPchikichikiba gu mousozokuTIKP-062TIKP062tikp00062
    • 2021-10-25
    15 min

    FC2PPV 2368983 [Interview] Cum Swallowing Challenge Without A Blow Job Of A Neat And Clean Gal (19 Years Old) Cum Swallowing Interview ＃ 14

  • amateur uncensoredfc2
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-12
    89 min

    529STCV-036 The Flag-Raising With Adult Sex Appeal The Carnivorous Unequaled Female President Appeared! !! The Woman Who Can Work Is Also Top-Notch! Any Man Can Do It With Super-Dreadnought Tongue Technique! A Model-Class Slender Beauty Squirts Indec

  • amateur censoredcreampieamateurstcvstcv-036stcv036529stcv-036
    • 2021-11-25
    240 min

    [SW-812]Step-daughter Gives A Panty Shot With Her Curvy Ass That"s Just Too Much Temptation! "Tell Me More About The Naughty Things Step-mom Can"t Know About" Fakecest Dream Special - Step-daughter And Step-dad Compilation. That Body

  • censoredSWswitchyocchanswitch switchSW-812SW8121sw00812
    • 2021-11-26
    62 min

    300NTK-664 [Yodare Beauty Big Tits] [Beauty Complete Awakening] [Disturbance Gonzo 2nn] The Mouth On Kimatte Is Also Drooling And The Mouth Underneath Is Really Wet! !! Beautiful Big Breasts Swaying And Swaying De Nasty Nature Release Whitening Mochi

  • amateur censoredcreampiesquirtingntkntk-664ntk664300ntk-664
    • 2021-11-29
    68 min

    [SHN-069]Touching OK! Girls 2021 Cosplay Girl Fucked At The Culture Festival And Her Hips Start Moving On Their Own

  • censoredbig titsblowjobSHNnatural highitaka smithlin powdernatsu carefully selected daughterSHN-069SHN0691shn00069



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored