cuckold ntr jav censored javcensored incest




FC2SSISNNPJGVHPPPDSHKDHNDMEYDCESDCHRVMILKIPXHZGDSDABCAWDPREDAUKGCJODBLKADNBBAN

2020-09-25
70 min

[STKO-022]SOD Bar Document: Picking Up Tipsy Girls - The Case Of Yuri Aizawa

  • yurina aizawa censoredbig titssingle workSTKOsod createmantaro yumetipsy reverse flirtingSTKO-022STKO0221stko00022
    • 2020-09-25
    38 min

    FC2PPV 1514220 [Until 9/30 1980] A simple and lascivious 20-year-old Tohoku JD girl ❤️ Listen to her boyfriend’s complaints, eat and take a raw squirrel while sleeping ❤️ Even though she bursts into amazing vaginal pressure, a large amount of va

  • amateur uncensoredfc2
    • 2020-10-01
    123 min

    [DROP-049]Sticky Cum Facial Fluids!! These Amateur Girls Are Getting Their First Dark Dildo Masturbation Pleasure 2

  • censoredamateurDROPoffice k sdrop office k sDROP-049DROP04936drop00049
    • 2020-10-01
    61 min

    [SIROR-030]MILF For Hire -The Hidden Side Of A Mature Woman Her Husband Never Sees File No. 30 -

  • censoredcreampiebig titsSIRORamateur dispatch.comSIROR-030SIROR030h-1492siror00030
    • 2020-10-11
    55 min

    FC2PPV 1530799 Idol ♀ J②] partⅡ 〇Twin angels who picked up in a bag are brought into the spear room and Gonzo seeding [Super beautiful woman with a slope face x 2]

  • amateur uncensoredfc2
    • 2020-10-19
    36 min

    FC2PPV 1539829 [Personal shooting / Creampie] I bought a 30-year-old married woman who was bred. I continued to groan in agony and pleasure repeatedly due to relentless denma blame …

  • amateur uncensoredfc2
    • 2020-10-23
    140 min

    [EKAI-018]Married Woman Servant Breaking In Club - Akari Niimura

  • akari shinmura censoredanaldeepthroatEKAIwaap entertainmenttakuanblakEKAI-018EKAI0182ekai00018
    • 2020-11-01
    120 min

    [UKM-003]Adultery Hot Springs: Wet And Erect vol. 3

  • censoredmarried womanmature womanUKMflowers and honeyshohei shimaUKM-003UKM003ukm00003
    • 2020-11-07
    140 min

    [URKK-032]While My Father (He's The Director Of A Hospital) Was Away, And As My Boyfriend Sat Beside Me, This Creepy Doctor Kept Creampie Fucking Me, And He Kept Making Me Cum Sachiko

  • sachiko censoredcreampiebig titsURKKunfinishedrolanda familiar breastURKK-032URKK032urkk00032
    • 2020-11-08
    57 min

    476MLA-006 The tide doesn’t stop ww I doubt my eyes at the too erotic foolery of a serious and neat nursery teacher … Creampie SEX in which the seeds are poured so that the pregnancy juice overflows! !! !!

  • amateur censoredcreampiesquirtingmlamla-006mla006476mla-006
    • 2020-11-20
    188 min

    [ABW-027]Creampie Ejaculation Bailif 08: Get Your Impure Sperm Squeezed By A G-cup Girl With Colossal Tits Riding You In A Hard Cowgirl Position!! Minamo Nagase

  • minase nagase censoredcreampiebig titsABWprestigehirahira hendorikkusuabsolutely wonderfulABW-027ABW027118abw00027
    • 2020-11-22
    148 min

    [JUL-380]I Can't Ever Tell My Wife, My Stepmom Has A Pregnancy Fetish For Me... I Forgot Myself And Creampied Her During A 1-night And 2-day Hot Springs Trip. Rin Ogawa

  • rin okae censoredcreampiebig titsJULmadonnaunicorn fukudaJUL-380JUL380jul00380
    • 2020-11-25

    FC2PPV 1583663 * Limited [Uncensored] A fair-skinned simple girl who came to Tokyo from the countryside. Continuous ejaculation-drinking (45 minutes)

  • amateur uncensoredfc2
    • 2020-11-27
    59 min

    [oretd-805]ゆきねさん

  • amateur censoredcreampieamateuroretdoretd-805oretd805oretd-805
    • 2020-12-03
    92 min

    [hoi-148]胡桃(21)

  • amateur censoredamateurbeautiful girlhoihoi-148hoi148hoi-148
    • 2020-12-08
    487 min

    [MUCH-118]Super Heavyweight! Super Bouncy BOX 8 Hours, 4-disc Set

  • megumi okamoto aoi kuroki censoredbig titsMUCHmothermuchi mutchiMUCH-118MUCH118h-796much00118
    • 2020-12-14
    57 min

    FC2PPV 1587215 The rumored super cute 18-year-old second work on the way back from the cram school, a dense secret meeting at the hotel, a large possibility that the van will end immediately, with the first limited privilege

  • amateur uncensoredfc2
    • 2020-12-24
    56 min

    345SIMM-581 Tutor enthusiastically cums 4 times with J ● and forbidden sex education training

  • amateur censoredcreampieuniformsimmsimm-581simm581345simm-581
    • 2020-12-27
    120 min

    [BIJN-191]The Documentary She's Baring Her Instinct To Fuck And Enjoy Orgasmic Sex A Tall And Beautiful Married Woman Moans And Groans In Mind-Blowing Orgasmic Pleasure Kotono Nanasaki

  • kotono nanasaki censoredcreampiesingle workBIJNbijin majo emmanuelleBIJN-191BIJN191bijn00191
    • 2021-01-17
    134 min

    [SORA-291]Infidelity Is Her Hobby - Faithless Wife Squirting For Adulterous Fucks - This Serial Cheater's Pussy Is Drenched. Adultery Trip With Her Fuck Buddy Right Under Her Husband's Nose. This Shocking Exhibitionist Cums 34 Times Before Sh

  • censoredSORAyama to sorahimu lockSORA-291SORA291sora00291
    • 2021-01-21
    127 min

    [AKDL-079](A Big Tits Amateur) This Babe With Super I-Cup Beautiful Big Tits Has Only Fucked Once In Her Life, But She Turned Out To Be A Horny College Girl Who Enjoys Masturbation Every Day At Her Home Hana

  • censoredbig titsamateurAKDLaquinoristickaknrAKDL-079AKDL0791akdl00079
    • 2021-01-29
    65 min

    Caribbeancom 012921-001 Like The Butterflies: Two Wheels Soapland In Pink Street 14 HITOMI, Yumi Kamiya

  • hitomi yumi uncensoredcreampiecaribbeancom
    • 2021-02-06
    121 min

    [SSNI-983]This Fresh Face Manager Will Usually Manage The Team With A Smile On Her Face, But The Truth Is She Cannot Physically Handle Being Around The Big Dick Team Members, But After The Game, They Were Pumped Up And Full Of Adrenaline, And So... L

  • kodama rena censoredsquirtingsingle workSSNIs1 no 1 stylesuisei akaiSSNI-983SSNI983ssni00983
    • 2021-02-06
    190 min

    [HUNTA-938]The 3rd Year Class 4 Group Put Out A Refreshment Booth At The Cultural Fair... And It Turned Out To Be A Go Go Bar At The Cultural Fair Of This Private Young Ladies' Academy The Most Popular Refreshment Booth Every Year, Which Has Line

  • censoredcreampieschoolgirlHUNTAhuntermasanorihhh groupHUNTA-938HUNTA938hunta00938
    • 2021-02-21
    82 min

    345SIMM-612 Super super huge breasts! Keep an eye on the sensitive decameron that is overflowing with www about the matter of having the best love love holiday by eating and playing with the miracle I cup J ○! Wrap your uncle in a nice fluffy body th

  • amateur censoredbig titsuniformsimmsimm-612simm612345simm-612
    • 2021-02-27
    121 min

    [WAAA-038]"Huh？! Did You Just Cum Inside Me？!" - He Tries To Cover Up His Premature Ejaculation By Continuing To Piston Fuck Her Even After He's Cum!! - Sora Minamino

  • minano sora censoredcreampieschoolgirlWAAAwanz factorywanzWAAA-038WAAA038waaa00038
    • 2021-03-15
    70 min

    491TKWA-163 Brown Half J ○ With Outstanding Style And Raw Creampie Video

  • amateur censoredcreampiebig titstkwatkwa-163tkwa163491tkwa-163
    • 2021-03-21
    118 min

    [HND-964]My Fiancee Confessed To Me That Right Before Our Wedding, My Dad Had Impregnated Her. And He Had Gotten To Creampie Fuck Her Before I Got The Chance Amu Hanamiya

  • hanamiya amu censoredcreampiebig titsHNDhon nakakitorune kawaguchiHND-964HND964hnd00964
    • 2021-03-27
    62 min

    1Pondo 032721_001 Great Shooting: Reina

  • amateur uncensored1pondo
    • 2021-03-27
    59 min

    292MY-415 Akina Inamura

  • amateur censoredmarried womanamateurmymy-415my415292my-415
    • 2021-04-11

    FC2PPV 1764598 Limited number [Uncensored] Bakery signboard girl JD ③ Staying at a trouble consultation Bukkake / Creampie on a beautiful big butt

  • amateur uncensoredfc2
    • 2021-04-27
    65 min

    FC2PPV 1790483 First shot ❤️ Amazing waist 54 cm! A large amount of sperm was thrown into a slender beauty’s tiny pussy ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-05-03
    70 min

    376H-612 Bondage innocent uniform girls ●● Squid with SEX! ＃ Nozomi ＃ 18 years old

  • amateur censoredcreampieuniformhh-612h612376h-612
    • 2021-05-11
    142 min

    1Pondo 051121_001 Nozomi Nakase : Nozomi Nakase Special Edition

  • amateur uncensored1pondo
    • 2021-05-14
    118 min

    [MVSD-463]Your Buddy's Sister Tried To Tempt You Into Losing Your Virginity To Her, But She Had No Idea How Much You'd Learned From Porn! The Tables Are Turned As You Rail Her To Incredible Orgasms, And She Agrees To Your Creampie! Sakura Tsu

  • sakura tsuji censoredcreampieslutMVSDm s video groupMVSD-463MVSD463mvsd00463
    • 2021-05-14
    240 min

    [HUNTB-015]"Your Cum Gets Me So Horny!" None Of The Girls At School Like Me, But My Brand New Stepsister Turned Out To Be A Blowjob Junky？! She Seemed So Cute And Innocent...

  • censoredschoolgirlblowjobHUNTBhuntercognac kaminohhh groupHUNTB-015HUNTB015huntb00015
    • 2021-05-20
    59 min

    SIRO-4525 [First shot] [Fluffy busty lewd JD] [Even if you die ..] A 20-year-old female college student who is curious. A busty girl who does naughty things with school girls has been passed away by a cock for the first time in a long time .. Applica

  • amateur censoredbig titsamateursirosiro-4525siro4525siro-4525
    • 2021-06-04
    60 min

    326GCP-003 Slutty Amateur 100 A Wheat Skin Gal Who Has Just Frustrated By Saffle Finds Onaho At The Nayo Boy’s Home And Laughs While Playing Evil Dick Aya 22 Years Old D Cup

  • amateur censoredamateurslutgcpgcp-003gcp003326gcp-003
    • 2021-06-09
    93 min

    459TEN-020 [This slender huge breasts are erotic! ] Assault on the home of an H-cup female college student captured in Nakano! !! Bombshell fuck with a special game underwear for gals! !! Fucking in the car! !! In addition, at the hotel, poke a fox m

  • amateur censoredcreampiebig titstenten-020ten020459ten-020
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-24
    125 min

    [FSDSS-243]A Job-Hunting College S*****t With Big Tits Has Sex In The Workplace And Discovers An Erotic Side Of Herself - Minamo Nagase

  • minase nagase censoredbig titsFSDSSfalenodream snowballfaleno starFSDSS-243FSDSS2431fsdss00243
    • 2021-07-06
    139 min

    [STARS-413]Innocent, Fresh-Faced Hostess With Sensitive Big Tits - She Gets Turned On Too Easily When Customers Come On Too Strong And She Can't Resist Fucking Them! Himari Asada

  • himari asada censoredbig titssingle workSTARSsod createshinya kimuraSTARS-413STARS4131stars00413
    • 2021-07-22
    119 min

    [WAAA-085]The Tight Cowgirl Sex Is So Good She Comes Multiple Times True Loving Creampie Bathhouse Nanase Asahina

  • asahina nanase censoredcreampiesingle workWAAAwanz factorywanzWAAA-085WAAA085waaa00085
    • 2021-07-28
    85 min

    428SUKE-081 [Yukata + Aphrodisiac Flood Sex! ？？ ] Borrow A Mobile Battery And Get Tipsy Yukata Beauty And Pakopako Sp! !! I Can’T Wait To Get To The Hotel, And I Can’T Wait To Blame The Tongue By Car. Fujiyama Splash Dalian Buchi Rise Www [

  • amateur censoredcreampieamateursukesuke-081suke081428suke-081
    • 2021-08-07
    239 min

    [NASH-555]4 Hours Of Voyeur Footage From A Love Hotel 3 - Cheating Wives, MILF Escorts, Horny Female Bureaucrats And Businesswomen - 18 Couples Secretly Filmed Sucking And Fucking During Lockdown

  • censoredmature womanNASHnadeshikoloveho tousatsu.networkNASH-555NASH555nash00555
    • 2021-08-07
    240 min

    [NASH-550]Wives That Fall For Another Man"s Dick - In Front Of Their Husband

  • censoredcreampieNASHnadeshikoNASH-550NASH550nash00550
    • 2021-08-19
    21 min

    HEYZO 2594 Kurumi’s Orgasms With Toys – Kurumi Chino

  • kurumi chino uncensoredheyzo
    • 2021-09-07
    77 min

    FC2PPV 2172312 * Body Barre Deletion Project [Rumored Super Popular Jemaru P Active Beautiful Girl And Translation Ali Yen Active Virgin W Pussy With Continuous Vaginal Cum Shot 3p Vaginal Cum Shot Video Leaked Ww Satisfaction Is Odd …] * There

  • amateur uncensoredfc2
    • 2021-09-23
    125 min

    [FSDSS-288]First Day At The Store. Super High Class Soapland 120 Minutes Course

  • rin natsuki censoredbeautiful girlFSDSSfalenokitchomfaleno starFSDSS-288FSDSS2881fsdss00288
    • 2021-09-24
    119 min

    [HMN-048]THE FIRST TAKE I Want To Become A Sexy Voice Actress! She Took On This Babymaking, Erotic And Grotesque Script And Redubbed All The Dialogue In One Continuous Take, Filled With Raw Cocks And Creampie Sex Aoi Amano

  • ao amano censoredcreampiebig titsHMNhonnakataiga kosakaiHMN-048HMN048hmn00048
    • 2021-10-14
    60 min

    C0930 ki211014 Yoshino Sasahara 39years old

  • amateur uncensoredc0930
    • 2021-10-15
    155 min

    [PPPD-965]Welcome The Pleasure Resort!! Enjoy Hard And Tight Titty Services At This Sensual Consecutive Cum Shot Men"s Massage Parlor!! Alice Kisaki

  • kisaki alice censoredcreampiebig titsPPPDoppaiPPPD-965PPPD965pppd00965
    • 2021-10-29
    151 min

    [MIAA-511]I"m Her Homeroom Teaher, But I Gave In To My S*****t"s Temptation And So, After School, We Went To A Love Hotel, And Had Creampie Sex, Over And Over, And Over Again ... Noel Honda

  • honda noeru censoredcreampieschoolgirlMIAAmoodyzsapporo tarouminna no kikatanMIAA-511MIAA511miaa00511
    • 2021-10-29
    178 min

    [JUFE-341]A Perfect Day for a Date in Tokyo. SEX With No Make-Up On. Rena Momozono

  • reina taoyuan censoredbig titssingle workJUFEfitchJUFE-341JUFE341jufe00341
    • 2021-12-14
    128 min

    [KTRA-355]Record Of My Niece And Uncle "Riina" Riina Asuka

  • rina asuka censoredcreampiebig titsKTRAk tribeKTRA-355KTRA355
    • 2021-12-23
    125 min

    [ARMF-021]Full Body Female Body Pictorial Book Showing While Masturbating Instruction No.1

  • rurucha kagura rin censoredanalARMFaroma planningfemale body fetishismARMF-021ARMF021armf00021



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored