def javcensored married woman jav blowjob




FC2VEMAAWDSSISHMNMARAPPPDMILKATIDCHRVSANHZGDMEYDROYDFSDSSMIDEWANZSSNIWAAAMVSDNNPJ

2020-11-06
120 min

[SSNI-911]This Elite Investigator Was Degraded With Aphrodisiacs And Turned Into A Golden Body Cum Bucket, Without Ever Taking Off Her Clothes Amu Hanamiya

  • hanamiya amu censoredbig titssingle workSSNIs1 no 1 styleichigoharaSSNI-911SSNI911ssni00911
    • 2020-11-07
    239 min

    [MLSM-033]Top Class Hot Mature Highlights Chisato Shoda 4 Hours, Voluptuous Beauty! 2

  • shota chisato censoredcreampiebig titsMLSMmellow moonMLSM-033MLSM033mlsm00033
    • 2020-11-07
    240 min

    [MMMB-036]An Old Lady With Short Hair! She's Got A Neckline That You'll Want To Suck And Slurp! 4 Hours

  • censoredcreampiebig titsMMMBmellow moonpig momMMMB-036MMMB036mmmb00036
    • 2020-11-14
    58 min

    Pacopacomama 111420_384 Reika Yoshimi

  • reika yoshimi uncensoredcreampieblowjobpacopacomama
    • 2020-12-02
    140 min

    [ARM-927]Massage Parlor With No-Ejaculation Policy But The Girls Keep Pushing Their Tits In My Face And Finally Bring Me To Cum While Pretending It's Accidental

  • censoredbig titsARMaroma planningshigeo kadowakiaromaARM-927ARM927arm00927
    • 2020-12-10
    133 min

    [RCTD-370]Dirty-Talking Mistresses Taking Care Of Jizzness

  • yuri sasahara minami saya censoredslutRCTDrockettaro kanbeRCTD-370RCTD3701rctd00370
    • 2020-12-13
    108 min

    [VEC-457]Married Woman Next Door Arouses Me, A Cherry Boy, With Her Front Hook Bra And Small Panties Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsVECvenuspetermegami venusVEC-457VEC457vec00457
    • 2020-12-20
    115 min

    [HND-930]Busty Female Teacher All Alone With Her Hung S*****t At A Love Hotel... She Only Brought One Condom Because They Were Only Supposed To Fuck Once, But She Had To Have Another Helping Of His Huge Cock And Took His Creampie. Nene Tanaka

  • nene tanaka censoredcreampiebig titsHNDhon nakanaveHND-930HND930hnd00930
    • 2020-12-23
    82 min

    300MIUM-670 [Baby-faced G cup] Educational toys VS sex toys. Play with abundant and bubbly beauty big tits with children’s toys. What is the accelerating sense of immorality, the sensitivity of the nipple that increases contrary to the will, and

  • amateur censoredbig titsamateurmiummium-670mium670300mium-670
    • 2021-01-01
    134 min

    [EKDV-652]Natsu Tojo Makes Males Subs Cum Buckets! These Desperate Guys Plead To Get Off And Natsu Makes Their Dreams Cum True!

  • natsu tojo censoredcreampiesquirtingEKDVcrystal picturekintaro okumae kissEKDV-652EKDV65249ekdv00652
    • 2021-01-12
    79 min

    [LOOTA-032]Lolita - Kannon Momojiri

  • momojiri kanon censoredsingle workLOOTAsupa kubijonLOOTA-032LOOTA0325433loota00032
    • 2021-01-31
    482 min

    [JUJU-263]Beautiful Wives Only - Gorgeous Married Sluts Pounded Right Down To Their Wombs With Massive Cocks! Moaning In Ecstasy For Creampie Fucks! 40 Girls, 8 Hours

  • censoredcreampiemature womanJUJUjukujo japanJUJU-263JUJU263juju00263
    • 2021-02-01
    62 min

    Pacopacomama 020121_429 Rental wife who does perfect sexual job Aina Kitahara

  • amateur uncensoredpacopacomama
    • 2021-02-01
    193 min

    [HR-004]Nipple Store: Super Sensitive A-cups No Milk, But That Makes Me More Sensitive - Rion Izumi

  • rion izumi censoredcreampieamateurHRplumhimu lockshirouto only plumHR-004HR004h-113hr00004
    • 2021-02-04
    14 min

    S-Cute 811_neiro_03 Vertical shooting cowgirl that comes to the back / Neiro

  • neiro censoredamateurneironeiro-03neiro03811-neiro-03
    • 2021-02-06
    77 min

    300MAAN-623 [If you take it off, it’s amazing No1 x pure white G milk x obscene costume sexual intercourse] Youthful big breasts layer is disturbed by erotic cute & metamorphosis costumes! Thoroughly massage the marshmallow boobs! It’s

  • amateur censoredcreampiebig titsmaanmaan-623maan623300maan-623
    • 2021-02-18
    98 min

    [KAAD-052]My Hot Mother-In-Law Kaoru Yuki

  • kaoru yuki censoredcreampiemarried womanKAADcenter villagejiro fukagawahanazono center villageKAAD-052KAAD052h-086kaad00052
    • 2021-03-06
    170 min

    [HUNBL-036]You Chased Away My Beloved Stepmom, So I'm Never Going To Forgive You! When My Dad Got Remarried, I Fucked My New Stepmom And Big Sister-In-Law And Filmed It POV Style, And Everyone Said, "Your Family Is Pretty Fucked Up ..."

  • censoredcreampiesisterHUNBLhunteraldebaranhhh groupHUNBL-036HUNBL036hunbl00036
    • 2021-03-19
    240 min

    [SORA-300]Blowjob Friend Overnight Date Ranran

  • orchid censoredblowjobSORAmountain and sky delusion groupelectric trainmountains and skySORA-300SORA300sora00300
    • 2021-03-19
    104 min

    [VENX-018]Clan G*******ging Sex A Pretty Auntie Aya Shiomi

  • aya shiomi censoredcreampiemature womanVENXvenuskaniefakecest winntersVENX-018VENX018venx00018
    • 2021-03-26
    118 min

    [CLUB-634]I Fell In Love With A Cheerful Slut And Seduced Her By Pretending I Was A Virgin. She Couldn't Help But Want To Break In A Sweet, Shy Boy Like Me And The Moment My Cock Met Her Big Tits She Fell In Love With My Erection. Part Two.

  • censoredbig titsuniformCLUBhentai shinshi clubCLUB-634CLUB634club00634
    • 2021-03-28
    45 min

    HEYZO 2490 Sex With A Married Woman In Kimono – Yuriko Wakana

  • yuriko wakana uncensoredcreampieheyzo
    • 2021-03-31
    125 min

    [GVH-212]Titty-Loving Shota's Lewd Prank Tomoko Kamisaka

  • tomoko kamisaka censoredbig titssingle workGVHglory questtorindoru tanakaGVH-212GVH21213gvh00212
    • 2021-04-15
    120 min

    [SYKH-024]She Cums Quick - Plump, Pale-Skinned Married Slut In Glasses - She Came To The Big City To Cheat - Hinata, Age 23

  • censoredcreampieamateurSYKHleisurely missus emmanuelleSYKH-024SYKH024sykh00024
    • 2021-04-30
    45 min

    H4610 ki210502 Rei Tanaka 19years old

  • amateur uncensoredh4610
    • 2021-05-01
    180 min

    [JUL-565]Married Woman With A Hand So SK**led It Could Be Considered A Weapon Takako Izumi 36 Years Old Works At A Famous Cosmetics Shop Porn Debut

  • takako izumi censoredbig titsmature womanJULmadonnakannana dainanaJUL-565JUL565jul00565
    • 2021-05-21
    64 min

    FC2PPV 1829605 060 [Large amount of vaginal cum shot and abdominal ejaculation] I injected a large amount of conceived juice of a small student into the body of a newlywed Hoyahoya’s best friend’s wife (Former model x newlywed bride x super

  • amateur uncensoredfc2
    • 2021-05-28
    133 min

    [PED-009]When The Two Of Them Were Left Alone For 7 Hours, They Had Sex 11 Times. Kaho Imai

  • natsuho imai censoredbig titssingle workPEDdream ticketkurumi ichinosePED-009PED00924ped00009
    • 2021-06-04
    50 min

    520SSK-007 Walnut

  • amateur censoredamateurbeautiful girlsskssk-007ssk007520ssk-007
    • 2021-06-19
    61 min

    Caribbeancom 061921-001 Sex with her husband’s best friend: she has been frustrated with her husband who has ED…Riri Shiraki

  • riri shiraki uncensoredcreampiecaribbeancom
    • 2021-06-26
    55 min

    H4610 ki210627 Chinatsu Kitada 29years old

  • amateur uncensoredh4610
    • 2021-07-04
    92 min

    522DHT-0278 Living in Daikanyama x Second Year of Marriage Creampie Welcome Wife Nozomi 28 Years Old

  • amateur censoredcreampiebig titsdhtdht-0278dht0278522dht-0278
    • 2021-07-14
    117 min

    [MVSD-471]Remote Control Cuckoldry: Listening To My Beloved Wife Moan As She Is Taken By Another Man, Starring Michiru Kujo

  • kujo michiru censoredcreampieblowjobMVSDm s video groupbungo maedaMVSD-471MVSD471mvsd00471
    • 2021-07-17
    189 min

    [REXD-371]Fucked In Front Of My Boyfriend...Teacher On Patrol During The School Trip, "She Should Be Knocked Out, So There's No Way She'll Wake Up!"

  • censoredcreampieschoolgirlREXDredmanji groupREXD-371REXD371rexd00371
    • 2021-07-30
    115 min

    [ATID-471]The Barely Legal Girl Who Goes Crazy For A Big Black Penis. Ichika Matsumoto.

  • ichika matsumoto censoreduniformsingle workATIDattackershaga eitarouin madATID-471ATID471atid00471
    • 2021-08-12
    128 min

    [IENF-157]S********ls From A Famous Prep School See A Guy Jerk Off For The First Time! Watching Up Close, Their Pussies Throb As They Watch Him Precum And Hear Him Fap! They Blush And Ask For Raw Cock And Get A Creampie!

  • karen nanase jinno hina censoredcreampieschoolgirlIENFie nergytaiga kosakaiienfIENF-157IENF1571ienf00157
    • 2021-08-15
    56 min

    FC2PPV 2028637 [Individual Shooting 50] Complete Appearance 20-Year-Old Shaved Race Queen I’M Sorry For Squirting I’M Sorry At The End Cleaning Blowjob From Continuous Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-08-16
    67 min

    328HMDN-393 [I Hate It, But I Want To See It! ] Former Weather Older Sister Wife 26 Years Old Sns ＃ Wife Who Came By Sperm Donation Grabbed The Ribs And Continuously Vaginal Cum Shot. Convulsions Died Many Times To Crush The Uterus Of The Unequaled C

  • amateur censoredcreampiemarried womanhmdnhmdn-393hmdn393328hmdn-393
    • 2021-08-31
    60 min

    Pacopacomama 083121_525 The Truth About a Tour Conductor’s Eroticism Mika Iwasaki

  • amateur uncensoredpacopacomama
    • 2021-09-02
    15 min

    Caribbeancom 090221-001 Pussy Encyclopedia : Asaka Sera

  • asaka sera uncensoredcaribbeancom
    • 2021-09-03
    149 min

    [CLUB-651]Sweaty Ex-gangster Housewife Has Filthy D***k-Fucking Trip With Her Younger Worker. Miss Nishimura, 36 Years Old.

  • censoredcreampiebig titsCLUBhentai shinshi kurabuCLUB-651CLUB651club00651
    • 2021-09-10
    214 min

    [HUNTB-093]"You"re Always Looking At My Tits, Aren"t You...？" A Quiet And Shy Plain Girl Close To Me Is Hiding Both Her Massive Tits And Her Intense Sexual Desires! And I"m The Only One Who Finds Out...

  • censoredcreampiebig titsHUNTBhuntercognac kaminohhh groupHUNTB-093HUNTB093huntb00093
    • 2021-09-11
    61 min

    519MAZOF-015 [Gold Comes Out From The Hole In The Pussy! ] Bank Clerk 24 Years Old ♀ [Training Pickled] If You Call During A Break And Limbs, The Pussy Will Get Soaked! If You Hit The Ass And Pierce The Uterus, The Demon Acme → I’m Sorry! I̵

  • amateur censoredcreampiebig titsmazofmazof-015mazof015519mazof-015
    • 2021-09-18
    120 min

    [KSBJ-158]My New Stepmom Plays With Me - Mio Saionji

  • mio saizonoji censoredcreampieblowjobKSBJksb kikaku emmanuellesakura ninKSBJ-158KSBJ158ksbj00158
    • 2021-10-10
    74 min

    534IND-002 Uniform Gachi Beautiful Girl! !! Raw Iki Attitude Is Also Raw Ji ○ Ko And Intense Piss Vaginal Cum Shot Success Or Failure! !! A Large Amount Of Sperm Leaked From Raw Ikima ○ In The Second Round Of Vaginal Cum Shot Without Permission! !! T

  • amateur censoredcreampiebig titsindind-002ind002534ind-002
    • 2021-10-16
    119 min

    [AVSA-181]The Filthy And Obedient Pet Gets Tied Up By The Queen, Gets A BUKKAKE, And Gets Wet From Sex. Mitsuki Nagisa

  • scooping censoredbeautiful girlsingle workAVSAavsjinguuji hikariavscollectorsAVSA-181AVSA181avsa00181
    • 2021-10-29
    98 min

    420HOI-205 Noa (Sasaki Noa)

  • amateur censoredbig titsamateurhoihoi-205hoi205hoi-205
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-01
    96 min

    FC2PPV 2395645 ☆ First Shot ☆ Complete Appearance ☆ F Cup Beauty Busty Apparel Clerk ♥ One-Sided Girlfriend Who Likes To Exhaust ♥ It’S Been A Long Time Since Sex Was Too Exciting And Cum Shot As It Is ♪ ♥ [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-11-05
    122 min

    [NKKD-232]Seduced by Housewife Working Part-Time at Family Restaurant. Seduced Me With Boobs and Made Me Cum All Over Them. Miina Wakatsuki

  • miina wakatsuki censoredslutsingle workNKKDjet eizougroupNKKD-232NKKD232nkkd00232
    • 2021-11-16
    57 min

    FC2PPV 2437384 Legal Dick Exposed In Brazilian Wax And No Hand Ejaculation W [CFNM]

  • amateur uncensoredfc2
    • 2021-12-05
    52 min

    FC2PPV 2487932 Why Does She Feel So Good With The Rumored [Moe Kyun] Slow No-Hand! Taking Advantage Of Her Shy Personality, She Takes Off Her Pants In The Car And Closes Her Eyes To The Elder Who Smells In Front Of Her …

  • amateur uncensoredfc2
    • 2021-12-17
    120 min

    [MIAA-550]My Former Classmate Is A Tanned Gal Who Used To Bully Me, But Now, To My Surprise, She Has Become My Big Sister-In-Law! Since She"s No Longer Satisfied With Her Husband, This Bitch Has Taken To Tweaking My Nipples And Teasing Me To Deat

  • ranka censoredcreampieblowjobMIAAmoody scaptain gangwoneveryone s kikatanMIAA-550MIAA550miaa00550
    • 2022-01-14
    121 min

    [MIAA-565]The Female Manager Of The Training Camp, Who Has Always Wanted To Be A Manager, Had Her Pussy Blistered By The Pistoning Of The Members Of The Club, And Her Sperm Flowed Backwards.

  • white peach censoredcreampiebeautiful girlMIAAmoodyzdragon nishikawaeveryone s porn starMIAA-565MIAA565miaa00565
    • 2022-01-15
    60 min

    Pacopacomama 011522_594 An Aggressive Mature Woman Who Invites You At The Entrance Yuko Amakata

  • amateur uncensoredpacopacomama
    • 2022-01-17
    79 min

    345SIMM-689 A-Chan @ Shinjuku [Gal / Brown Hair / Girls ● Raw / Uniform / Miniskirt / Raw Feet / Beautiful Legs] #Underwear Voyeur #Train Molester #Home Invasion #Sleep Fuck

  • amateur censoredcreampieschoolgirlsimmsimm-689simm689345simm-689



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored