def mature woman hot spring jav javcensored




FC2ABWJUFESDABAUKGAVSAMIDEMIDVFSDSSMIAACHRVDTTMEYDCAWDLULUHODVKSBJROYDCJODVENXNATR

2020-11-22
147 min

[HND-909]Cunningly Cute Former Local Reporter First Raw Creampie Tsumugi Narita

  • narita tsumugi censoredcreampiebeautiful girlHNDhon nakamametaro mamezawaHND-909HND909hnd00909
    • 2020-11-22
    172 min

    [AKID-078]College Girls Only! I Took Her Back To My Room After A Party And Shot A Secret Video. I Was Quiet About This And Went To AV no.42: Slutty Huge Breasted Girls, Creampie Edition: Mami/Approximate G-cup, 21 Years Old (She Likes Older Men, So S

  • censoredcreampiebig titsAKIDomochikaeri mousozokumanji groupAKID-078AKID078akid00078
    • 2020-11-24
    142 min

    [SDMM-078]One-Way Mirror Cab - Nurses Only! "Would You Give A Massive Cock A Medical Examination？" Angels In White Soothe Guys With Dick Trouble Every Way They Know How 2

  • censoredamateurhandjobSDMMsod createanzomagic mirrorSDMM-078SDMM0781sdmm00078
    • 2020-12-05
    119 min

    [PRED-276]After School Slut Class. I Can't Tell A Soul That My Teacher Gives Me His Creampie Daily... Yuria Satomi Hijiri Maihara

  • satomi yuria kiyoshi maihara censoredcreampieslutPREDpremiumtrendy yamaguchielegancePRED-276PRED276pred00276
    • 2020-12-14
    23 min

    FC2PPV 1606646 ☆ Complete appearance ☆ Beautiful girl similar to a former gravure idol again ♥ Service to the master ♥ Rich vaginal cum shot with maid cosplay SEX ♪ [with ZIP]

  • amateur uncensoredfc2
    • 2020-12-17
    99 min

    [OKSN-312]MILFs Gone Wild... Stepmoms Desperate For Their Stepsons' Cocks Ambush Them In Best! Made To Get Hard Again And Again - 2 Rounds Of Pounding

  • censoredblowjobmomOKSNabc mousouzokuokasan.comOKSN-312OKSN312oksn00312
    • 2020-12-20
    116 min

    428SUKE-054 [Sensitive slender beautiful girl who goes crazy in the back] Borrow a mobile battery and candy girls and Pakopako SP! !! All-you-can-eat beautiful body! Thorough electric blame from big screen AV viewing! Big Penis Cheek Sixty Nine! Tast

  • amateur censoredamateurbeautiful girlsukesuke-054suke054428suke-054
    • 2020-12-22
    61 min

    Pacopacomama 122220_401 Rika

  • rika uncensoredblowjobpacopacomama
    • 2020-12-25
    99 min

    300MIUM-664 Infinite convulsions “Oni de M” gal! !! !! [SSS class gal with a high facial deviation value with a drinker! !! !! ] × [The highest erotic potential! !! !! Transcendental sensitive constitution & metamorphosis faucet Ma ● Th

  • amateur censoredamateurmiummium-664mium664300mium-664
    • 2021-01-08
    243 min

    [MGT-131]Pickin Up Amateur Girls On The Street! Vol. 98 - Poolside Pickups 2020 1

  • censoredsquirtingamateurMGTprestigemegatraMGT-131MGT131118mgt00131
    • 2021-01-23
    176 min

    [CAWD-173]Preppy College Girl From Prestigious Institution Is Also A Popular Akihabara Maid - Massive Squirting Orgasms Getting Fucked 3 Times In Sexual Awakening - Mone Kouno

  • mone kamishiraishi censoredsquirtingsingle workCAWDkawaiikannana dainanaCAWD-173CAWD173cawd00173
    • 2021-01-23
    153 min

    [HND-937]A Fresh Face Babe Who Provides Great Service And Is A Genius At Sex!! This Hard-Working Beautiful Girl Has Experience In Over 50 Different Types Of Customer Service Jobs, And Now, She's Finally Arrived At Her Ultimate Destination... A Re

  • censoredcreampiebeautiful girlHNDhon nakamametaro mamezawaHND-937HND937hnd00937
    • 2021-01-24
    140 min

    [KSAT-031]Super Cute Busty Slut Picked Up For A Creampie - Noa Futsuka (Pseudonym), 5' F-Cup

  • censoredcreampiebig titsKSAThard table delusion groupsixmanhard tableKSAT-031KSAT031ksat00031
    • 2021-01-25
    66 min

    [SHH-018]Tiny-Titted Slut Cries Out For Cock... And Teases It Until You Cum!

  • censoredbeautiful girlslutSHHnatural highSHH-018SHH0181shh00018
    • 2021-01-26
    59 min

    HEYZO 2447 Gravid Teacher Is Dying To Have Sex! – Nanako Asahina

  • nanako asahina uncensoredcreampieheyzo
    • 2021-01-30
    76 min

    [ssan-016]かほさん

  • amateur censoredbig titsamateurssanssan-016ssan016ssan-016
    • 2021-02-11
    178 min

    [NHDTB-492]This Office Lady Got A Remote-Controlled Vibrator Shoved Into Her Pantyhose, And Now She's Unable To Withstand The Pleasure As She Dribbles Pleasure Piss Down Her Beautiful Legs

  • censoredsquirtingNHDTBnatural highkansukeNHDTB-492NHDTB4921nhdtb00492
    • 2021-02-15
    17 min

    FC2PPV 1687749 1200pt → 599pt Super super beautiful! A very rare beautiful girl, a 19-year-old beautiful girl, keeps watching the phone while having sex with her boyfriend! This is the most beautiful girl I have ever seen! Please download as soon as

  • amateur uncensoredfc2
    • 2021-02-23
    83 min

    464STST-015 Airi

  • amateur censoredbig titsamateurstststst-015stst015stst-015
    • 2021-02-26
    238 min

    [ASI-031]A Married Woman's First-time Shots - I Will Fuck A Married Woman In POV Now.

  • censoredbig titsamateurASIprestigekanbiASI-031ASI031118asi00031
    • 2021-03-01
    123 min

    [NACR-399]The Hot Wife Next Door What Happened When She Entered The Wrong House Risa Mochizuki

  • risa mochizuki censoredcreampieslutNACRplanet plusdirector onanakuruNACR-399NACR399h-237nacr00399
    • 2021-03-12
    84 min

    [ETQR-204](Daydream POV) Sex For Money WIth A Runaway Girl Suzu-chan

  • censoredcreampieuniformETQRerotic timeETQR-204ETQR204h-1186etqr00204
    • 2021-03-12
    76 min

    [DORI-014]Sex Film No. 14 Slender Innocent S********l With Beautiful Legs Is Shy After Not Fucking For A While But Is Soon Loving Having Her Bald Pussy Pounded

  • censoredcreampieschoolgirlDORIfirst starsucking shootingDORI-014DORI014h-491dori00014
    • 2021-03-12
    92 min

    380SQB-092 Tsubasa

  • amateur censoredbig titsamateursqbsqb-092sqb092380sqb-092
    • 2021-03-13
    75 min

    FC2PPV 1724162 ☆ 700pt OFF until March 21st for a limited time! !! !! [No / individual] Punishment play with shy chubby Masami-chan and Pichi Pichi uniform ♪ * There is a face-up review privilege

  • amateur uncensoredfc2
    • 2021-03-20
    61 min

    Caribbeancom 032021-001 Alternated BJ And Insert 4 Momoka Ogawa

  • momoka ogawa uncensoredcreampiecaribbeancom
    • 2021-03-23
    60 min

    FC2PPV 1737660 4 months pregnant! !! , 21-year-old F-cup real pregnant woman’s vaginal cum shot support contract until childbirth Completely original 110th person

  • amateur uncensoredfc2
    • 2021-03-26
    54 min

    FC2PPV 1742624 [* White eyes attention *] 5P orgy ★ Ai Yak ★ A female college student who trembles with a lively face while peeling white eyes with Gangimari is too erotic! Super penis and muscular man gorilla SEX are dangerous. [Very ejaculated]

  • amateur uncensoredfc2
    • 2021-04-08
    122 min

    [FSDSS-199]Prison Number 666 - Spell Trap Sora Amakawa

  • tenkawa sora censoreddeepthroatsingle workFSDSSfalenowild sevenfaleno starFSDSS-199FSDSS1991fsdss00199
    • 2021-04-08
    123 min

    [DLDSS-002]This Hot Married Woman Was Too Horny: Even Though She Was Happy With Her Husband, She Couldn't Stay Chaste Ayaka Tomoda

  • ayaka tomoda censoredcreampiemarried womanDLDSSdahliadream snowballDLDSS-002DLDSS0021dldss00002
    • 2021-04-08
    54 min

    [230OREC-737]もね

  • amateur censoredcreampieuniformorecorec-737orec737230orec-737
    • 2021-04-09
    120 min

    [MUDR-144]I Still Won't Give In... Beautiful Girl Continues To Resist Until She's G*******ged. Breaking In A Proud Babe With S&M And Confinement - Mitsuki Nagisa

  • scooping censoredcreampiebdsmMUDRmukuMUDR-144MUDR144mudr00144
    • 2021-04-09
    166 min

    [MKMP-390]First Time Being Fucked Raw Three Times Getting Her Pussy Filled With Thick Cum Nako Hoshi

  • nako hoshi censoredcreampiebeautiful girlMKMPk m producezaku araimillionMKMP-390MKMP390mkmp00390
    • 2021-04-10
    63 min

    300NTK-550 [Cute & Beautiful Quarter Nice Bottom Beautiful Girl! !! ] Reiwa is so cute, but I like anime! !! It’s a star of otaku! !! Continuous vaginal ejaculation is inevitable with the discovery of "SEX is … I like rawness" !!

  • amateur censoredcreampieamateurntkntk-550ntk550300ntk-550
    • 2021-04-15
    76 min

    [AKDL-103](On The Job Cuckholding) Adulterous Foorage Of Man Seducing And Fucking His Coworker's Beautiful Wife During Work Asuka Hayasaka

  • asuka hayasaka censoredmarried womanamateurAKDLaquinoriaquinoriaknrAKDL-103AKDL1031akdl00103
    • 2021-05-07
    119 min

    [MEYD-676]The Truth Is, My Husband's Boss Is Fucking Me ... Tsubaki Kato

  • kato camellia kaoru natsuki censoredcreampiesingle workMEYDtameike goronaveMEYD-676MEYD676meyd00676
    • 2021-05-08
    122 min

    [BAHP-077]Luxury BDSM ~ More Sensual... I Can't Forget Her Body From Those Extraordinary Sexual Days ~ Azusa Kasahara

  • azusa kasahara censoredbig titsbdsmBAHPbaltanusubashisuihoppinBAHP-077BAHP077bahp00077
    • 2021-05-13
    132 min

    [JRZE-049]First Time Filming My Affair Chihiro Hanamura

  • chihiro hanamura censoredcreampiemature womanJRZEcenter villageminami daichishoku ureJRZE-049JRZE049h-086jrze00049
    • 2021-05-22
    140 min

    [DBER-112]Drowning In Pleasure Before She Meets Her End - Hellish Ecstasy In Defeat EPISODE 10: Highly Trained Female Flesh Meets Its Match! Proud Grappler Brought Low And Ravished Ayaka Mochizuki

  • ayaka mochizuki censoredsingle workDBERbabyentertainmentkikubonred babeDBER-112DBER112dber00112
    • 2021-06-13
    66 min

    SIRO-4547 AV application on the net → AV experience shooting 1561 [First shot] [Idol face JD] [Foot pin died] A beautiful girl college student who died with a sweet voice. She fascinates orgasms that can’t be imagined from her neat appearance.

  • amateur censoredamateurbeautiful girlsirosiro-4547siro4547siro-4547
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-07
    125 min

    SMUK-058 Rara

  • amateur censoredcreampieschoolgirlsmuksmuk-058smuk058smuk-058
    • 2021-07-09
    110 min

    300NTK-601 Drunk 4P! !! The W cowgirl where the slender beauty body of a new graduate OL who is too beautiful dances warped is a masterpiece! !! With the finest technique that does not seem to be a newcomer, insert the Gachibokki boss Ji ○ into the o

  • amateur censoredcreampieamateurntkntk-601ntk601300ntk-601
    • 2021-07-17
    61 min

    519MAZOF-007 [Browsing Self-Responsibility] Up-And-Coming Female Calligrapher 29 Years Old [Fusion Of Calligraphy And Power Elegant] Masochist Woman Who Exposes Her Boobs Boobs And Cum Shot [Personal Shooting] Karen Aihara

  • amateur censoredcreampiebig titsmazofmazof-007mazof007519mazof-007
    • 2021-07-24
    240 min

    [HUSR-240]The Country With The Most Beautiful Women In The World! Special Collection Of The Ultimate Weapons From Russia, The Kingdom Of Beauties! Who Ever Knew Russia Had Such Amazing Women？!

  • isabel clark ibana censoredcreampiebig titsHUSRbig mocalbooker thustleHUSR-240HUSR24057husr00240
    • 2021-07-27
    102 min

    451HHH-028 AV First Experience [Iki Sweat! ] [Lots Of Juice! ] [Hot And Humid Sex! !! ] Frustration ● This Favorite Nurse Challenges Her Climax Limit! High Viscosity, Super Close Contact Copulation That Is Born For The First Time When Serious Sexual

  • amateur censoredamateurhhhhhh-028hhh028451hhh-028
    • 2021-08-01
    61 min

    HEYZO 2578 Naked Girlfriend POV -Raven Haired Slutty Amateur Girl- – Nobuko Matsumoto

  • amateur uncensoredcreampieheyzo
    • 2021-08-07
    122 min

    [DVAJ-527]ドクドク中出ししてる最中もベロキスしたまま腰振り続ける密着騎乗位お姉さん 川上奈々美

  • kawakami nanami censoredcreampieschoolgirlDVAJalice japankirinDVAJ-527DVAJ527dvaj00527
    • 2021-09-12
    112 min

    FC2PPV 2192550 ★ First Shot Super Dangerous Video ☆ Beautiful Girl Distributor Famous On The Net! Ena 〇 Rukinoko ☆ ♥ ️ Electric Ma Squirting Iki ♥ ️ Tension？ Pleasure？ Impact Sex While Crying ♥ ️ [4k Image Quality 3 Hours 23 Minutes]

  • amateur uncensoredfc2
    • 2021-09-17
    58 min

    230OREC-884 Meru

  • amateur censoredcreampiebig titsorecorec-884orec884230orec-884
    • 2021-09-20
    98 min

    [KIR-043]It All Started When I Bumped Into My Step-Aunt Who Was Covered By Only Her Bath Towel...Nanami Mineta

  • nanami mineda censoredcreampiesingle workKIRstar paradisekirei star paradiseKIR-043KIR043h-254kir00043
    • 2021-09-25
    121 min

    [SMCP-002]Full Fantasy Sex Of Nene Tanaka With Baby Face And Big Tits

  • nene tanaka censoredcreampiebig titsSMCPsmartmedia production mousouzokumaruchi vitaminSMCP-002SMCP002smcp00002
    • 2021-10-02
    139 min

    [MMUS-057]Small, Devilish And Provocative Beautiful Girl - Ena Satsuki

  • ena satsuki censoredbeautiful girlslutMMUSmarrionkasai kijinkcpMMUS-057MMUS057mmus00057
    • 2021-10-02
    122 min

    [KTKC-127]The Strongest Amateur Nympho Whom I Ever Encountered Was A Massage Parlor Girl Who Had Colossal Tits: Yayoi (H-Cup).

  • censoredbig titsamateurKTKCkichikkusu mousou zokukyonyuuKTKC-127KTKC127ktkc00127
    • 2021-10-09
    141 min

    [DNJR-059]The Story of Yuna Himekawa"s Enticement and Confinement of, and Breaking In, a Masochistic Male. Yuna Himekawa

  • yuuna himekawa ran tsukishiro censoredbeautiful girlslutDNJRinu mousozokumaboroshi koDNJR-059DNJR059dnjr00059
    • 2021-10-25
    45 min

    274DHT-0318 Young Wife Has A Strong Libido! It Is Called A Massage And Seduces By Playing With The Body Of An Acquaintance’s Husband. The Last Is A Couple Exchange Swapping Orgy!

  • amateur censoredcreampiebig titsdhtdht-0318dht0318274dht-0318



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored