def slender javcensored cowgirl censored




FC2SQTEHNDSPRDCAWDHDKAAWDCHRVDTTNACXRBDAUKGAVSAGVHMARAAUKSATIDAMBIKBIGMEMSAN

2021-11-06
57 min

[CSDX-017](4K) Cosplay x Aoi Kururugi 6 - Aoi Kururugi

  • aoi kururugi censoredblowjobcosplayCSDXcosdeluxeCSDX-017CSDX017h-1558csdx00017
    • 2021-08-13
    240 min

    [OOMN-275]A Slender, Beautiful Girl Agonizes By Instinct and Reaches Her Climax. Mitsuha Higuchi.

  • mitsuha higuchi censoredbeautiful girlOOMNabc delusion groupmom.com abc delusion groupOOMN-275OOMN275oomn00275
    • 2021-03-12
    118 min

    [DHT-242]Porno Return Second Debut! Makoto Hoshimura 32 Years Old

  • makoto hoshimura censoredmature womanDHThot entertainmentblade take leeDHT-242DHT24259dht00242
    • 2021-02-24
    48 min

    [CSDX-006](4K) Cosplay + Aoi Kururugi 3 Aoi Kururugi

  • aoi kururugi censoredblowjobcosplayCSDXcosdeluxeCSDX-006CSDX006h-1558csdx00006
    • 2021-02-02
    60 min

    [KBTV-060]"Actually, I'm Worried My Cock Is Too Big" If We Confessed To Being Hung, Would A Girl's Curiosity And Maternal Instinct Get The Better Of Her？ We Find Out

  • censoredamateurKBTVmessy tvKBTV-060KBTV060h-1514kbtv00060
    • 2021-02-01
    38 min

    [PYU-127]Indeed, She Is A Super Ripe Slender And Beautiful Mature Woman, And She Served His Lively Cock And Made Him Cum Like A Champ! Maki Hojo

  • hojo asahi censoredmature womanPYUcome camPYU-127PYU127h-1462pyu00127
    • 2020-12-16
    68 min

    [EMOI-042]Close Reporting On The Life And Times Of A Sexy Youtube Star With Big Tits From Osaka - She Straddles Male Subs And Teases Their Nipples During Hard-Humping Cowgirl Sex. Tsukino Nonomiya / Freaky Hot Babe.

  • tsukino nonomiya censoredbig titsEMOIsod createtiger gavelemo girlEMOI-042EMOI0421emoi00042
    • 2020-12-12
    79 min

    [HHKL-076]When We Missed Our Last Train Home, I Spent The Entire Night Fucking My Part-Time Job Co-Worker Until The Break Of Dawn, And That Day, We Felt Like Lovers. Chiharu Sakurai

  • chiharu sakurai censoredcreampiebeautiful girlHHKLhunterspace nyanjirohhh groupHHKL-076HHKL076hhkl00076
    • 2020-12-02
    59 min

    [KBTV-041]The Shyest Girl You'll Ever Meet. But Once She Talks To You Will She Let You Go All The Way？ We Find Out!

  • censoredamateurblowjobKBTVmessy tvKBTV-041KBTV041h-1514kbtv00041
    • 2020-12-02
    62 min

    [KBTV-045]We Wanted To Test This Theory: Is A Woman Who Is Hanging Out By Herself In The Afternoon An Easy Lay？

  • censoredamateurblowjobKBTVmessy tvKBTV-045KBTV045h-1514kbtv00045
    • 2020-11-13
    47 min

    [CRNX-007]Sexless Before They Knew It... Breaking In These Middle-Aged Men For A Second Time Vol. 1 Miku Abeno

  • miku abe censoredcreampieblowjobCRNXcrystal picturekintaro okumacrystal nextCRNX-007CRNX00749crnx00007
    • 2020-11-13
    50 min

    [CRNX-009]Realizing They Are Sexless...Older Men Have The Second Taste Of Sex In Their Life Vol.3 Aoi Kururugi

  • aoi kururugi censoreduniformblowjobCRNXcrystal picturekintaro okumacrystal nextCRNX-009CRNX00949crnx00009
    • 2020-11-02
    64 min

    [KBTV-037]Will A Girl Who Believes In Horoscopes Fall For Our Fake Fortune Teller？ How Easy Is It To Get Laid If You Tell Her It's Fate？ We Find Out

  • censoredamateurKBTVmessy tvKBTV-037KBTV037h-1514kbtv00037
    • 2020-02-14
    157 min

    [MDBK-084]Pussy-Pounding Piston Cowgirl Sex Repeated Orgasmic P-To-M Sex

  • roaring sound kuraki bookmark censoredcreampiebig titsMDBKmedia stationquatcheebazookaMDBK-084MDBK08461mdbk00084
    • 2020-02-08
    120 min

    [MIDE-740]"Hey, You Can Cum Again, Right？" This Cool Beautiful Girl Will Mount You For A Cowgirl And Shake Her Ass On You Without Asking For Your Permission Special Miyu Misaki

  • misaki misaki censoredbeautiful girlslutMIDEmoody sichiro kanedamoodyz divaMIDE-740MIDE740mide00740
    • 2019-12-04
    72 min

    [SHN-026]Slow, Passionate Sex On A Futon - A Married Woman With A Beautiful Body Can't Help Doing Embarrassing Queefs - "I'll Let You Do It Bareback, So Fuck Me One More Time..." - She Feels So Good With A Cock In The Back Of Her Puss

  • censoredcreampiemarried womanSHNnatural hightanaka baconnatsu carefully selected daughterSHN-026SHN0261shn00026
    • 2019-07-20
    149 min

    [KAWD-994]She's Naturally The Giving Type When It Comes To Sex. Dirty Cowgirl Sex With A Girl With A Divine Waist. Student Nurse, Karen Makes Her Kawaii* Porn Debut

  • censorednurseKAWDkawaiixKAWD-994KAWD994kawd00994
    • 2019-02-08
    158 min

    [MKMP-261]Kizuna Sakura A Beautiful Ass Deep Pussy Slow Sex

  • sakura kizuna censoredMKMPkm producetequilatinomillionMKMP-261MKMP26184mkmp00261
    • 2018-10-26
    60 min

    [WKD-010]Provactive Interview Room Shino Aoi

  • megumi shino censoredblowjobWKDwarp entertainmentk westwWKD-010WKD0102wkd00010
    • 2018-10-21
    151 min

    [HND-584]Flirtatious Provocative Dance. Fucking At Full Power And Making Men Come Until The Music Stops. Creampies. Akari Mitani

  • mitani akari censoredbeautiful girlHNDbooknanzaki masakiHND-584HND584hnd00584
    • 2018-09-08
    159 min

    [MIAE-307]Female Teacher With A Tight Skirt's Thick Thigh Temptation Total Domain Yui Hatano

  • yui hatano censoredMIAEmoody shironori miyasemoodyz acidMIAE-307MIAE307miae00307
    • 2018-09-06
    139 min

    [STAR-967]Masami Ichikawa. From Fast To Slow, Teasing, Gear-Changing Blowjob

  • masami ichikawa censoredblowjobSTARsod createnanzaki masakisod starSTAR-967STAR9671star00967
    • 2018-08-16
    118 min

    [SSNI-281]Back to Back Twitching Pussy Unforgiving Hardcore Fuck Minami Kojima

  • minami kojima censoredsquirtingSSNIs one number one styleusapyons1 no 1 styleSSNI-281SSNI281ssni00281
    • 2018-08-16
    180 min

    [SSNI-288]Saika Kawakita Exciting Whore First Experience Slave 7 Rotating Full Course

  • ayaka hebei censoredbeautiful girlSSNIs one number one stylecrests1 no 1 styleSSNI-288SSNI288ssni00288
    • 2018-08-12
    148 min

    [DVAJ-345]My Big Sister And I Are Enjoying A Sex Life Right On The Edge Of Incest, Because She Lets Me Stick In 3cm Of My Cock Into Her Pussy Ai Hoshina

  • sena ai censoredDVAJalice japanviva gonzoDVAJ-345DVAJ345dvaj00345
    • 2018-08-11
    153 min

    [MIAE-292]No Stress For Master: Cowgirl Vacuum Stroke That Makes You Climax With One Thrust Yui Tomita

  • yu tomita censoredsquirtingbeautiful girlMIAEmoody sdragon nishikawamoodyz acidMIAE-292MIAE292miae00292
    • 2018-07-28
    152 min

    [MIAE-286]Tanned-Ass, Fast-Fucking Bubble-Butt Babe Who Likes To Ride Cowgirl Style Aika

  • aika censoredbig titsslutMIAEmoody sdragon nishikawamoodyz acidMIAE-286MIAE286miae00286
    • 2018-07-14
    118 min

    [SSNI-263]Flesh Fantasy Twitching And Trembling Sex With An Exquisitely Beautiful And Muscular Body, Honed And Trained Through Sex Toka Rinne

  • roaring sound censoredbig titssquirtingSSNIs one number one stylecrests1 no 1 styleSSNI-263SSNI263ssni00263
    • 2018-06-17
    166 min

    [KAWD-908]A Major New Fresh Face! This Shy Girl Has An Angelic Smile Sora Asahi 20 Years Old A Kawaii* Exclusive Debut

  • morning su censoredbeautiful girlKAWDkawaiinishinakajima southKAWD-908KAWD908kawd00908
    • 2018-06-14
    140 min

    [SSNI-239]Mixed Body Fluids, Deep Sex Totally Uncut Special Ami Ayuha

  • ayuha ami censoredsquirtingSSNIs one number one stylemichiru arashiyamas1 no 1 styleSSNI-239SSNI239ssni00239
    • 2018-06-02
    150 min

    [SSNI-223]She Went From Her First Ever G-Spot Blossoming Fuck To Suddenly Cumming 108 Times In A Full Body Trembling Spasmic Orgasmic Repeated Cumtastic G-Spot Rush Ann Tsujimoto

  • an tsujimoto censoredsquirtingbeautiful girlSSNIs one number one stylecrests1 no 1 styleSSNI-223SSNI223ssni00223
    • 2018-05-26
    147 min

    [MIAE-247]A Peachy Ass Up Close And Personal Slave Maid Yu Shinoda

  • shinoda yu censoredbig titsMIAEmoody sdragon nishikawamoodyz acidMIAE-247MIAE247miae00247
    • 2018-05-21
    139 min

    [XVSR-376]Genuine Creampie 3 Mami Nagase

  • asami nagase censoredcreampiesquirtingXVSRmax ak c takedacalenXVSR-376XVSR376xvsr00376
    • 2018-05-17
    139 min

    [RKI-468]The World's Most Pleasurable And Exotic Ass Shaking Cowgirl Sex & Grinding Cowgirl Fucking Honed By Belly Dance Training Minori Kawana

  • real village hena censoredcreampiebeautiful girlRKIrookienanzaki masakiRKI-468RKI468rki00468
    • 2018-05-12
    151 min

    [EBOD-635]Kanae Is A Waitress At A Stylish Cafe In The City Who Is Kind And Gentle And Can't Say No, So When We Got Her Naked We Found Out That This Baby-Faced Girl Had A Slender Big Tits Body Like A Super Model And We Were So Astounded By This T

  • censoredbig titsamateurEBODe bodyEBOD-635EBOD635ebod00635
    • 2018-04-15
    103 min

    [TIKF-020][A Goddess With A Small Waist] We Drugged A Totally Sadistic And Cool Slender Beauty With Light Skin With Some Aphrodisiacs And Now She Became A Panting And Drooling Creampie Begging Bitch LOL

  • censoredcreampiebeautiful girlTIKFchikikikikama delusion groupTIKF-020TIKF020tikf00020
    • 2018-04-12
    143 min

    [HAWA-138]An Amateur Wife Who Lets University Students Fuck Her For One Night At Their Houses If They Provide A Condom Is No Longer Satisfied, And Winds Up Letting Them Creampie Her On The Second Night Kaho-san (32), A Slightly Sadistic Slender Wife

  • censoredcreampiemarried womanHAWAcosmos videomountain forestcosmos video soft on demandHAWA-138HAWA1381hawa00138
    • 2018-04-07
    147 min

    [MIFD-037]An Otaku Girl Who Attends Anime School And Has Unbelievable Sexual Hunger Is Making Her AV Debut Sora Kamikawa

  • kamikawa starry sky censoredsquirtingcosplayMIFDmoody stake dmoodyz freshMIFD-037MIFD037mifd00037
    • 2018-02-24
    148 min

    [EYAN-110]A Former Celebrity Housewife Haruku Takaoka This Married Woman With A Miraculously Slim Body Is Lifting Her Sex Ban An E-BODY Massive New Face Debut

  • takaoka sky censoredmarried womansquirtingEYANe bodyhanazakari wivesEYAN-110EYAN110eyan00110
    • 2018-01-27
    226 min

    [MIDE-505]Chinami Ito Was Forbidden To Fuck For A Month And Now She's Being Teased With Pull Out Sex Over And Over Until She Reaches Her Upper Limit And After Her Sensuality Hit Its Peak She Entered Into A Massive Trance Orgasmic State

  • chinami ito chinami ito censoredbeautiful girlMIDEmoodyzMIDE-505MIDE505
    • 2017-12-27
    169 min

    [IPX-068]This Elder Sister Has Ultra Amazing Sex Techniques To Make Any Man A Spineless Puddle Of Cum You've Never Seen Or Experienced Sex Like This Clara Manase

  • aiyo kurara censoredslutIPXidea pocketxtissueIPX-068IPX068ipx00068
    • 2017-12-09
    149 min

    [MIAE-159]A High Class Slave Maid Who Will Keep You Fucking And Sucking Nao Wakana

  • nao wakana censoredbig titsMIAEmoody sdragon nishikawamoodyz acidMIAE-159MIAE159miae00159
    • 2017-07-29
    120 min

    [MEYD-285]Sending Out the Beastly Wives! Ecstatic Temptation of Filthy Perverts Leads to Creampie Sex Miho Tono

  • miho tsuno censoredcreampiemarried womanMEYDtameike goroomura universityMEYD-285MEYD285meyd00285
    • 2016-06-30
    148 min

    [WANZ-514]Sports Cosplay Lust! Clothed Cowgirl Creampie Tsubomi

  • bud censoredsquirtingcosplayWANZones factorywanzWANZ-514WANZ514wanz00514
    • 2015-09-10
    118 min

    [EBOD-465]E-BODY Exclusive Debut Beautiful 8-Heads-Tall Yu Misaki

  • yu misaki censoredbig titsEBODe bodyEBOD-465EBOD465ebod00465
    • 2015-09-01
    149 min

    [AVOP-128]Sweaty Ass Double Cast Ayumi Shinoda Yui Oba

  • ayumi shinoda oba yui censoredsquirtingAVOPteppanav open 2015AVOP-128AVOP128avop00128
    • 2015-06-04
    118 min

    [SNIS-423]Mixed Body Fluids, Deep Sex Yua Ariga

  • ariga your censoredSNISs one number one stylecrests1 no 1 styleSNIS-423SNIS423snis00423
    • 2015-06-03
    122 min

    [ECB-093]She Pulls Back Just As Guys Are About To Cum Until They Melt With Pleasure Yuki Natsume

  • yuki natsume censoredblowjobslutECBwarp entertainmentyumeno aidacobra warpECB-093ECB0932ecb00093
    • 2015-04-10
    141 min

    [XVSR-051]Fresh Face - First Ecstasy Rin Amane

  • amane ri censoredXVSRmax asono kanoliviaXVSR-051XVSR05160xvsr00051
    • 2012-09-28
    129 min

    [HMN-001]Are You Serious!？ You Can Cum Using Just Your Nipples!？ A Tweaking, Twisting, No-Hands, Out-Of-Control Nipple Orgasm! This Slutty Nipple-Tweaking Elder Sister Type Babe Won't Give You Any Time To Rest After Ejaculating Because She'll

  • ai junsai censoredcreampieslutHMNhypnosis research institutehypnotic apartmentHMN-001HMN001h-443hmn00001
    • 2012-09-21
    118 min

    [HND-026]Sticky Fuck and Creampie with an Older Sister Burning with Desire Sarina Takeuchi

  • takeuchi sharina censoredcreampieHNDbookgoemonHND-026HND026hnd00026
    • 2012-06-20
    126 min

    [HMN-003]Ultra-Slim, Beautiful Girl's Enthusiastic Cowgirl Leads To Her First Ever Creampie Hinano Tachibana

  • censoredcreampiebeautiful girlHMNhypnosis research institutehypnotic apartmentHMN-003HMN003h-443hmn00003
    • 2011-02-26
    169 min

    [MIDD-747]Orgasmic Sex That Doesn't Stop At 10 Cums In A Single Day Miho Ashina

  • haruna miho inamori shiori censoredMIDDmoody stake dmoodyz divaMIDD-747MIDD747midd00747
    • 2010-08-13
    118 min

    [MIAD-473]Vacuum Pussy Yua Kisaki

  • princess ai anna nagasawa rika mizuhara yuko kizaki censoredMIADmoody skatsuyuki hasegawamoodyz acidMIAD-473MIAD473miad00473



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored