digital mosaic high vision censored javcensored older sister




FC2MILKSDABPPPDAMBIHMNCESDAPODAUKSATIDRBDHZGDCAWDCHRVAVSADASDDASDSHKDADNMIDEPRED

2019-05-11
150 min

[IPX-310]Relentless Creampie Cowgirl Sex With An Insatiable Young Lady Who Won't Let You Pull Out No Matter How Many Times You Cum Tsubasa Amami

  • amami tsubasa censoredcreampieslutIPXidea pocketmon cdishIPX-310IPX310ipx00310
    • 2019-05-11
    152 min

    [IPX-306]A Private Lesson In Seduction With Momo, The Female Teacher With Divine Tits. Momo Sakura. Your Teacher Will Make A Man Out Of You...

  • sakura sky momo censoredbig titsslutIPXidea pocketbungo maedadishIPX-306IPX306ipx00306
    • 2019-04-07
    151 min

    [MIAA-055]This Elder Sister Is A Distant Relative Whom I Only Meet Once A Year During The New Year Holidays. When I Had A Chance To Go To Tokyo, We Spent Some Time Together, And It Turned Out To Become A Bittersweet And Pale Memory Of First Love. Tsu

  • yano tsubasa censoredbig titssingle workMIAAmoodyzshiro shoteneveryone s porn starMIAA-055MIAA055miaa00055
    • 2019-04-07
    147 min

    [MIAA-056]The 2-Hole Molester Anal Gang Bang Orgasmic Aphrodisiac Degradation Rui Hizuki

  • rui hizuki censoredsingle workMIAAmoodyztequilia tinoeveryone s porn starMIAA-056MIAA056miaa00056
    • 2019-04-07
    119 min

    [IPX-298]Fucked By Her Senpai After Missing The Last Train Home. A Female Employee Gets Creampied Repeatedly All Though The Night By Her Boss. Nanami Misaki

  • nanami misaki censoredcreampieblowjobIPXidea pocketzaku araidishIPX-298IPX298ipx00298
    • 2019-03-30
    116 min

    [MIDE-639]The Teacher I Crushed On And Days Of Loving Sex After Graduation, Shoko Akiyama

  • shoko akiyama censoredsingle workdramaMIDEmoodyzshiro shotenmoodyz divaMIDE-639MIDE639mide00639
    • 2019-03-30
    149 min

    [MIAA-045]Sucking On Nipples And Dicks! Once He Cums, It's Time To Swap! The Relentless, Cum-Milking Harem Of Sluts! Mikan Kururugi Honoka Mihara

  • mandarin orange mihara honoka censoredbig titsblowjobMIAAmoodyzkogoro kindaichieveryone s porn starMIAA-045MIAA045miaa00045
    • 2019-03-10
    154 min

    [IPX-288]A Literature Student From A Prestigious University Makes Her Porn Debut In Search Of Someone To Cum Inside Her! She Loses Her Virginity At A Social Mixer During The Summer Of Her Freshman Year! This Girl Suddenly Takes Loads From 40 Differen

  • censoredcreampieIPXidea pockettake ddishIPX-288IPX288ipx00288
    • 2019-03-06
    120 min

    [JUY-787]My Sister-In-Law Keeps Stealing The Cum I Save By Staying Celibate For A Month So I Can Try For A Baby With My Wife. Tsubasa Hachino

  • yano tsubasa censoredcreampiebig titsJUYmadonnabieber gonzoJUY-787JUY787juy00787
    • 2019-02-23
    119 min

    [JUY-765]Mom's Friends - Kana Mito

  • kana mito censoredmature womanslutJUYmadonnajyoji kawaiJUY-765JUY765juy00765
    • 2019-02-16
    149 min

    [MVSD-376]Licking And Swallowing Cum. 2 Blowjob Loving Sluts GOLD. Deep Throat. Indiscriminately Hunting For Cocks To Milk!! Sena Asami, Anju Minase

  • ashamed anju minase censoredblowjobslutMVSDm s video groupsuisei akaiMVSD-376MVSD376mvsd00376
    • 2019-02-09
    150 min

    [IPX-275]ECSTASY MASTER Extreme Orgasm Technique Maniacs, Yu Shinoda

  • shinoda yu censoredbig titsslutIPXidea pocketxavier thomasdishIPX-275IPX275ipx00275
    • 2019-02-09
    118 min

    [MIAA-018]I Want You To Shove Your Cock In All The Way! I'm Living The Infidelity Life With My Girlfriend's Big Sister Who I'm Teasing By Poking The Tip Of My Cock Around Her Pussy And Pushing Her To The Limits Of Her Endurance Yui Hatano

  • yui hatano censoredslutsingle workMIAAmoodyzmametaro mamezawaeveryone s porn starMIAA-018MIAA018miaa00018
    • 2019-01-17
    160 min

    [MVSD-372]Merciless Throatfuck and Cum In Throat Brings Tears To Her Eyes! Sena Asami

  • ashamed censoredblowjobdeepthroatMVSDm s video groupkogoro kindaichiMVSD-372MVSD372mvsd00372
    • 2018-12-29
    120 min

    [JUY-720]My Mom's Friends Nanami Kawakami

  • kawakami nanami censoredmature womansingle workJUYmadonnajyoji kawaiJUY-720JUY720juy00720
    • 2018-12-22
    119 min

    [MIAE-358]"I Told You I've Already Ejaculated!" A Men's Massage Parlor With Consecutive Ejaculation Follow-up Squirting Service!! A Juicy Ejaculation Ecstasy Course Yu Shinoda

  • shinoda yu censoredbig titsslutMIAEmoodyzdragon nishikawamoodyz acidMIAE-358MIAE358miae00358
    • 2018-12-06
    167 min

    [PRED-118]Dripping Wet! A Perverted Golden-Shower Girl! Aika Yamagishi

  • aika yamagishi censoredcreampieslutPREDpremiumnao masakielegancePRED-118PRED118pred00118
    • 2018-12-06
    150 min

    [URE-046]First Film Adaptation! Created By Immoral NTR Author Arakure Married Teacher NTR Field Trip Featuring An Original Story That Takes Place Afterward! Sho Nishino

  • sho nishino censoredmature womansingle workUREmadonnakitorune kawaguchiure.comiURE-046URE046ure00046
    • 2018-11-23
    119 min

    [JUY-682]My Big Sister-In-Law Was Trying To Have A Baby, But She Ran Away From Home After A Fight With Her Husband, So I Secretly Creampie Fucked Her Riko Kishigami

  • reiko kishigami censoredcreampiebig titsJUYmadonnajyoji kawaiJUY-682JUY682juy00682
    • 2018-11-10
    197 min

    [IPX-225]Back By Popular Demand!! The Titty-Touching Pub Where You Can Go All The Way 2 & We Sneak Into A Titty-Touching Pub IRL And Have Real Sex. 2 Titles. 4 Sex Scenes. Momo Sakura

  • sakura sky momo censoredbig titssingle workIPXidea pocketzaku araidishIPX-225IPX225ipx00225
    • 2018-11-10
    120 min

    [MIAE-321]Sticking A Vibrator Covered In Aphrodisiac In A Young Lady With A Big Ass, With Her Asshole Fully Exposed!! We Leave Her Alone Until She Orgasms Yu Shinoda

  • shinoda yu censoredbig titssingle workMIAEmoodyzk westmoodyz acidMIAE-321MIAE321miae00321
    • 2018-11-10
    154 min

    [IPX-224]She Takes Advantage Of The Young Lust Of Her Naive Students. The One-On-One Lessons On Temptation With Miss An, The Nymphomaniac Teacher. An Hinohara

  • an hinohara censoredslutsingle workIPXidea pockettake ddishIPX-224IPX224ipx00224
    • 2018-11-10
    145 min

    [IPX-226]"I Already Came! Stop It!" Continuous, Relentless Fucking After An Orgasm. Relentlessly Fucking A Pussy That Just Came And Forcing Her To Have Another Orgasm! Tsubasa Amami

  • amami tsubasa censoredbig titssquirtingIPXidea pocketkahori maedanodishIPX-226IPX226ipx00226
    • 2018-11-10
    115 min

    [MIAE-335]Ever Since My Senpai From The Literature Club Who's A Year Older Than Me Took My Virginity, She's Been Raping Me For 3 Years... Nao Jinguji

  • jinguji temple nao censoredbeautiful girlslutMIAEmoodyzhiroamoodyz acidMIAE-335MIAE335miae00335
    • 2018-11-10
    157 min

    [IPX-223]"Look At My Tits..." The Temptation Of A Bra-Less Young Lady With Colossal Tits Spilling Out Of Her Clothes. For The Boob Fetishists! Hard-Ons Guaranteed! 6 Hot Situations. The Girl With The J-Cup, 100cm Tits Flashes Her Assets... Mi

  • miasaka mia censoredbig titssingle workIPXidea pocketinaballdishIPX-223IPX223ipx00223
    • 2018-11-03
    148 min

    [PRED-110]The Total Domain Of An Elder Sister In Knee-High Socks Who Is Giving Me The Golden Shower Slut Treatment Yu Asakura

  • yu asakura censoredslutsingle workPREDpremiumk westelegancePRED-110PRED110pred00110
    • 2018-10-12
    242 min

    [IPX-219]BEAUTY VENUS 5

  • there is hashimoto minami aizawa censoredslutIPXidea pocketusa pyondishIPX-219IPX219ipx00219
    • 2018-10-12
    479 min

    [IDBD-791]It's The 10th Anniversary Since Her Debut!! Jessica Kizaki 24 Red-Hot Fucks ENDLESS SUMMER SEX 8 Hours Best Hits Collection The Latest 9 Titles 24 Complete Sex Scenes! All The Best Nookie Scenes And Ejaculation Scenes In A Super Select

  • jessica kizaki censoredcreampieslutIDBDidea pocketidea pocket bestIDBD-791IDBD791idbd00791
    • 2018-10-12
    151 min

    [IPX-211]Drooling Deep And Rich Kisses And Sex With A Pretty Elder Sister Ann Hinohara

  • an hinohara censoredsquirtingslutIPXidea pocketusa pyondishIPX-211IPX211ipx00211
    • 2018-10-12
    119 min

    [IPX-214]A Deep And Rich Lesbian Ban Lifting! 4 Mutually Orgasmic Lesbian Series Sex Sessions A New Sensation Orgasmic Experience Twisting Tongues Intertwining While Their Pussies Rub Up Against Each Other... Only A Woman Could Know Another Woman

  • amami tsubasa yui hatano censoredbig titslesbianIPXidea pocketzaku araidishIPX-214IPX214ipx00214
    • 2018-10-11
    134 min

    [STAR-982]95 Cum Shots Of Bukkake Unleashed Amateur Men Are Releasing Ultra Rich And Thick Squirts Of Semen Masami Ichikawa

  • masami ichikawa censoredsingle workbukkakeSTARsod createtiger kosakaisod starSTAR-982STAR9821star00982
    • 2018-10-06
    120 min

    [PRED-104]A Young Lady Studying Liberal Arts Will Thoroughly Rape You In The Cowgirl Position. Nao Jinguji

  • jinguji temple nao censoredcreampiebig titsPREDpremiumsapporo taroelegancePRED-104PRED104pred00104
    • 2018-06-02
    120 min

    [PRED-080]The Man Who Turned Me Back Into A Bitch Saryu Usui

  • sakisui censoredcreampiesingle workPREDpremiumtorendei yamaguchiPRED-080PRED080pred00080
    • 2018-05-03
    194 min

    [PRED-068]I Was Unable To Move And Slut Fucked To Death By A Pretty Elder Sister Aika Yamagishi

  • aika yamagishi censoredcreampieslutPREDpremiumpiero taelegancePRED-068PRED068pred00068
    • 2018-04-07
    146 min

    [PRED-067]She's Starring In That Popular End-Of-The-Year Mixed Martial Arts Event! A Real Life Ring Girl Is Making Her AV Debut!

  • censoredsquirtingPREDpremiumcontour styleelegancePRED-067PRED067pred00067
    • 2018-03-31
    155 min

    [IPX-120]Rich And Thick Saliva Splattering Slobbering Kisses And Sex With A Big Titty Elder Sister Momo Sakura

  • sakura sky momo censoredbig titsslutIPXidea pocketusa pyondishIPX-120IPX120ipx00120
    • 2018-03-31
    119 min

    [MIAE-214]No Cock For You! Teasing With Nothing But Foreplay Yui Hatano

  • yui hatano censoredbig titssingle workMIAEmoodyztiger kosakaimoodyz acidMIAE-214MIAE214miae00214
    • 2018-03-31
    119 min

    [IPX-123]Nipples! Clits! Anal Fucks! A Triple Powered Orgasmic Ecstatic Endless Fuck No Matter How Many Times She Cums She Keeps Getting Tweaked In Non-Stop Lust Awakening Ecstatic Panting Pleasure And She Gets An Unbelievable Anal Fuck Too!! Tsubasa

  • amami tsubasa censoredanalbig titsIPXidea pocketzaku araidishIPX-123IPX123ipx00123
    • 2018-03-24
    153 min

    [IPX-115]Goopy Drippy Splattering Raw Creampie First Time Fucks Himawari Yuzuki

  • sunflower sunflower censoredcreampieslutIPXidea pocketkirindishIPX-115IPX115ipx00115
    • 2018-03-18
    179 min

    [PRED-057]Welcome All You Cherry Boy Lovers! A Kind And Gentle Cherry Popping With A Smile Aika Yamagishi

  • aika yamagishi censoredsingle workPREDpremiumkyoseielegancePRED-057PRED057pred00057
    • 2018-03-18
    120 min

    [JUY-434]This Married Woman Is Wickedly Smiling As She Continues To Tweak My Nipples, Getting Them Rock Hard And Ready Nozomi Tanihara

  • nozomi tanihara censoredmature womanslutJUYmadonnabieber gonzoJUY-434JUY434juy00434
    • 2018-03-10
    119 min

    [MIFD-034]She's Got Entertainment Industry Experience! This Cool And Beautiful Lady Will Transform Into A Filthy Whore Through Sex! A Grinding Cowgirl Edler Sister AV Debut Mika Sasahara

  • mika sugawara censoredsingle workMIFDmoodyzheavy smoky ishiiMIFD-034MIFD034mifd00034
    • 2018-03-08
    152 min

    [KMHR-028]I Fell In Love With You Because You Enjoyed Sex So Much That You Were Crying Tears Of Joy... Mei Iikura 24 Years Old She Made Her AV Debut During Her Engagement Chapter 1 2 Months Before She Was Set To Get Married, She Had Her First Fuck Wi

  • mei iikura censoredsingle workKMHRsod createlamb chopi fell in love with youKMHR-028KMHR0281kmhr00028
    • 2018-02-10
    151 min

    [IPX-094]Swapping Spit With Beautiful Elder Sister Wet Passionate Kissing and Sex - Ena Uemura

  • megumi uemura censoredslutsingle workIPXidea pocketusa pyondishIPX-094IPX094ipx00094
    • 2018-02-03
    120 min

    [JUY-381]Mom's Friends Sho Nishino

  • sho nishino censoredmature womansingle workJUYmadonnajyoji kawaiJUY-381JUY381juy00381
    • 2018-02-03
    118 min

    [MVSD-342]Time Stop Soap Land - Creampie for Legendary Big Titted Lady Popular in Nakasu - Mio Kimijima

  • kimishima mio censoredcreampiebig titsMVSDm s video groupkitorune kawaguchiMVSD-342MVSD342mvsd00342
    • 2018-01-07
    201 min

    [IPX-081]Genuine Creampie Raw Footage Sex Club 5 Fuck 200 Minute Private Reservation Special Course "5 Deep And Rich Creampie Raw Footage Episodes!" Tsubasa Amami

  • amami tsubasa censoredcreampiesingle workIPXidea pocketzaku araidishIPX-081IPX081ipx00081
    • 2017-12-09
    150 min

    [IPX-059]FIRST IMPRESSION 123 This Highly Sensual Elder Sister Got So Much Pleasure From Fucking These AV Actors That She Broke Down In Tears In This AV Debut! Ena Uemura

  • megumi uemura censoredsquirtingsingle workIPXidea pocketmamezawa mametarouIPX-059IPX059ipx00059
    • 2017-12-09
    166 min

    [IPX-062]The Tables Are Turned! Furious Pumping Action! Incredible Ecstasy! Massive Squirting! Before I Knew It, I Was Forced To Cum And I Was Transformed Into A Horny Bitch Of Pleasure... Ayumi Arihara

  • ayumi arihara censoredsquirtingslutIPXidea pocketxavier thomasdishIPX-062IPX062ipx00062
    • 2017-12-09
    119 min

    [IPX-064]Cock Orgasms With The Big Vibrator! A Hot Lotion Tornado Blowjob For A Back Breaking Ejaculatory Explosion! Watch The Queen Straddel You In An Explosive Sexual Display Of Amazing Technique!! All Episodes Feature Orgasmic Bursts Of Ejaculator

  • amami tsubasa censoredslutsingle workIPXidea pocketupdatingIPX-064IPX064ipx00064
    • 2017-12-09
    120 min

    [MIAE-157]An Elder Sister With An Amazing Bulging Bush!! Her Bushy Temptation Is So Thick I Just Can't Resist Lea Kashii

  • ria kashii censoredbig titsslutMIAEmoodyzgo uemonMIAE-157MIAE157miae00157
    • 2017-12-09
    119 min

    [MIFD-026]Dear Teacher, I've Cum 30 Times Already Nao Kiritani

  • naoki kiritani censoredbig titssquirtingMIFDmoodyzgo uemonMIFD-026MIFD026mifd00026
    • 2017-12-09
    120 min

    [IPX-065]"While I Was Away On Business..." Adultery NTR My Wife's Ex-Boyfriend Had Bad Intentions When He Filmed Himself Fucking Her And Streamed It Without Permission As An "Adultery Sex Video" Jessica Kizaki

  • jessica kizaki censoredsingle workIPXidea pocketupdatingIPX-065IPX065ipx00065
    • 2017-11-23
    243 min

    [TOMN-120]Teppan Complete Ian Hanasaki BEST A Neat And Clean Beautiful Girl Lures Men Into Lustful Sex

  • hanasaki ian censoredsingle workTOMNteppanupdatingTOMN-120TOMN120tomn00120
    • 2017-11-03
    160 min

    [HND-444]A Lusty Woman x An Orgasmic Man Raw Arousals! A Basic Instinct Genuine Creampie Unleashing!! Mio Kimishima

  • kimishima mio censoredcreampiebig titsHNDhon nakahirokoji osakiHND-444HND444hnd00444
    • 2017-11-03
    161 min

    [HND-448]His Girlfriend Was Right There, But She Kept Whispering Sweet Creampie Temptation Into His Ear Rika Mari

  • mari rika censoredcreampieslutHNDhon nakanao masakiHND-448HND448hnd00448



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored