documentary jav mature woman censored def




FC2MARASSISAUKSVENXJUFEFSDSSSPRDNACRCHRVSSNICESDMEYDHMNVEMAAMBIIPXBLKAUKGGVHSHKD

2020-09-25
100 min

SMUK-034 Nozomi 2

  • amateur censoredschoolgirlamateursmuksmuk-034smuk034smuk-034
    • 2020-09-27
    242 min

    [FSPT-003](Peachteen) Getting Naughty At School "Oh No I Hope Somebody Doesn't See Me..." Horny S********l's Secret Trysts On Campus - 6 Girls On Film -

  • censoredcreampiebig titsFSPTfirst starpeachteenFSPT-003FSPT003h-491fspt00003
    • 2020-09-29
    64 min

    HEYZO 2361 Sex Heaven -Flat-chested Girl Is Very Sensitive!- – Rina Suzuki

  • rina suzuki uncensoredcreampiehandjobheyzo
    • 2020-09-30
    57 min

    326PIZ-030 F cup fluffy pie female teacher brushes down her student’s virgin! !! A large amount of semen accumulated for one month is continuously vaginal cum shot and even if it is muddy Continue ww

  • amateur censoredcreampiebig titspizpiz-030piz030326piz-030
    • 2020-10-02
    188 min

    [DOCP-250]This Married Woman Got Fucked, But She Came Over And Over Again, And Now Her Pussy Won't Stop Spasming, So She Said, "I Don't Care If I Get Pregnant, You Have To Help Me!" And Then She Pressed Him Down And Demanded Consecuti

  • freedom chaoyang ema censoredcreampiebig titsDOCPprestigedoc premiumDOCP-250DOCP250118docp00250
    • 2020-10-10
    118 min

    [MUDR-126]Ever Since That Day... Breaking In A Beautiful Y********l In Uniform With S&M And Creampie Sex Rei Kuruki

  • satoshi kuruki censoredcreampiesquirtingMUDRmukuMUDR-126MUDR126mudr00126
    • 2020-10-15
    83 min

    [hoi-134]愛ちゃん(22)

  • amateur censoredamateurbeautiful girlhoihoi-134hoi134hoi-134
    • 2020-11-15
    67 min

    AVHD-102 Mona

  • amateur censoredbig titsamateuravhdavhd-102avhd102avhd-102
    • 2020-11-28
    140 min

    [MIFD-137]I Want To Be Prettier! A Curious Talent New Face Age 19 Tanned And Healthy Beautiful Girl AV Debut Toa Nanashima

  • toai nanami censoredbeautiful girlsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-137MIFD137mifd00137
    • 2020-12-04
    127 min

    [SGA-146]The Finest Lover, The Finest Creampie Sex. 60 - Slender Gorgeous Girl Wants A Creampie Rara

  • censoredcreampieamateurSGAprestigesetsugetsukaSGA-146SGA146118sga00146
    • 2020-12-12
    180 min

    [MIFD-140]A Fresh Face 19 Years Old Pleased To Meet You, My New Name Is Nana Yaotome. A Real-Life Idol Makes Her Adult Video Debut! You Couldn't Even Touch Her At Fan Events, But Now She's Immediately Grabbing Your Cock...!!!

  • nana yaotome censoredbeautiful girlsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-140MIFD140mifd00140
    • 2020-12-20
    111 min

    [OAE-204]ALL NUDE - Riri Nanatsumori

  • nanatsumori riri censoredsingle workOAEaircontrolzaku araiOAE-204OAE204oae00204
    • 2021-01-15
    331 min

    [YNPS-001]Quickly Picking Up Beautiful Bitches: Summer Pool Edition

  • censoredsquirtingbeautiful girlYNPSpetersnampaYNPS-001YNPS001h-021ynps00001
    • 2021-02-18
    81 min

    [ETQR-198][Daydream POV] Rich Sex With My Lovely S*****t In Uniform - Natsu Tojo

  • censoredcreampieuniformETQRerotic timeETQR-198ETQR198h-1186etqr00198
    • 2021-02-20
    41 min

    FC2PPV 1693906 [Personal shooting] Immediately Saddle SEX at the entrance with Miyabi-chan There is another angle

  • amateur uncensoredfc2
    • 2021-02-27
    90 min

    FC2PPV 1702653 Celebration! A total of over 20,000 thank-you projects! [Big Cock Big Mara Subordinate x Miraculous Beauty BODY Beauty and 3P] The daughter of the president’s daughter has also grown up w Drinking with 3 people and getting drunk a

  • amateur uncensoredfc2
    • 2021-02-28
    77 min

    300NTK-527 Echi Echi area development! !! H cup beauty x GAL x tide = the strongest P active women’s round begins! !! Negotiations struggle with firm greedy professional P girls! ？？ The weak point is squirting Ma Ko who is too binkan! !! The tot

  • hpnn censoredcreampiebig titsntkntk-527ntk527300ntk-527
    • 2021-03-13
    116 min

    [DPMI-057]Wonderful Queen REMI

  • remi censoredsingle workDPMImiludopamixDPMI-057DPMI057dpmi00057
    • 2021-03-16
    66 min

    200GANA-2401 In the spear room of the Nampa teacher of 100 battles, the grind cowgirl of the beautiful clerk caught in the pub was too erotic! Repeatedly inside the vagina with outstanding sensitivity, panting with the volume on the verge of complain

  • amateur censoredamateurganagana-2401gana2401200gana-2401
    • 2021-03-20
    80 min

    [FUFU-198]True Stories Of First Time Affairs I Triecked My Wife Into Going To Take Care Of A Friend And When They Were Alone Together He Seduced Her... Fumi Miyasawa (40)

  • fumi miyazawa censoredamateursingle workFUFUstar paradisefufuFUFU-198FUFU198h-254fufu00198
    • 2021-03-25
    20 min

    FC2PPV 1740786 [Saturday and Sunday limited sale] [Leaked] Rushed into a famous university Hamesa.

  • amateur uncensoredfc2
    • 2021-04-09
    120 min

    [MIDE-910]Limitless Pounding, Squirting Orgasms - Filthy Office Girl Offers Up Her Wet Pussy To Get Her Work Done! Ibuki Aoi

  • aoi ibuki censoredbig titssquirtingMIDEmoody sdragon nishikawamoodyz divaMIDE-910MIDE910mide00910
    • 2021-04-24
    131 min

    [MRSS-111]My Big Booty Wife Protected Me From Thugs, And They Ended Up Taking It Out On Her Body... Ema Asahi

  • chaoyang ema censoredcreampiesingle workMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-111MRSS111mrss00111
    • 2021-05-01
    120 min

    [SSIS-058]Shared Room NTR This New Employee Hates Her Middle-Aged Boss, But Now, During Their Business Trip, She Engaged In Adultery Sex With Him From Morning Until Night Riri Nanatsumori

  • nanatsumori riri censoredsingle workSSISs1 no 1 stylekitorune kawaguchiSSIS-058SSIS058ssis00058
    • 2021-05-07
    62 min

    [050721_001]おもてなし ～パイズリ上手な女たち～

  • amateur uncensored1pondo
    • 2021-05-20
    97 min

    [OFKU-181]Step Mother With A Huge Ass Visits From Iwaki...Fifty Something Stepmom Seiko Nagata

  • shigeko nagata censoredcreampiemature womanOFKUstar paradisemom railOFKU-181OFKU181h-254ofku00181
    • 2021-06-04
    122 min

    [HODV-21582](Complete POV) Girl With An Accent Hakata Dialect Saaya Matsui

  • saya matsui censoredcreampiesingle workHODVh m pHODV-21582HODV215825642hodv21582
    • 2021-06-11
    40 min

    FC2PPV 1862550 Limited number [Uncensored] Active professional student with a lovely smile like a girl! Raw vaginal cum shot at 19 years old! !!

  • amateur uncensoredfc2
    • 2021-06-12
    243 min

    [NSFS-001]Crying Temptation Miho Tono Best

  • miho tsuno censoredmarried womanmature womanNSFSnagae stylesano b sakutomi taketaroNSFS-001NSFS001nsfs00001
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-20
    129 min

    [CEMD-028]Pushed To The Upper Limit Of Nipple Pleasure! Sensitive Teats Teased Relentlessly! Mao Watanabe

  • mao watanabe censoredcreampieblowjobCEMDceleb no tomoCEMD-028CEMD028cemd00028
    • 2021-06-30
    103 min

    435MFC-119 [S-type big butt Shinmama who blames the younger man] Kansai dialect quarter Beautiful mom can not show it to her daughter! Cinderella time from "mother" to "woman" ♪ Sucking a young cock with a nasty tongue out blowjob, sw

  • amateur censoredcreampieamateurmfcmfc-119mfc119435mfc-119
    • 2021-07-02
    129 min

    [RBK-017]Beautiful Hostess: Rough Anal Reception Mako Oda

  • oda mako censoredanalsingle workRBKattackerskaoru okuzonoryupakuRBK-017RBK017rbk00017
    • 2021-07-06
    72 min

    493NAEN-077 Without permission! ？？ Half JD! ？？ Rubber ant circle ○ The case that it was light but it was vaginal cum shot with a big cock Otohana Eve

  • amateur censoredamateurbeautiful girlnaennaen-077naen077493naen-077
    • 2021-07-21
    37 min

    FC2PPV 1934313 Infiltrate A Secret Orgy ㉞ Perfect Hips ♥ Beautiful Ass Is Crowded With More Aggressive Ossans Than Usual! 5 Thick Sperms Dripping From The Nice Ass ♪ * High Quality Version & Review Benefits Included ★

  • amateur uncensoredfc2
    • 2021-07-22
    122 min

    [DLDSS-016]Melty Kiss: Adults Engaged In Hot Kisses And Sex. Rin Azuma.

  • dongguan censoredblowjoblingerieDLDSSdahliakei isoiDLDSS-016DLDSS0161dldss00016
    • 2021-08-20
    240 min

    [MGDN-158]When The Married Woman, Who Is An Insurance Salesperson, Proposes To Trade Filthy Sexual Favors... 240 Minutes

  • censoredmilfstepmomMGDNstar paradisemegadonMGDN-158MGDN158h-254mgdn00158
    • 2021-08-28
    240 min

    [MCSR-448]Shaved Pussy Wife - Wives With Smooth, Shiny Pussies - 18 People, 4 Hours

  • censoredamateurMCSRbigmorkalbanderas takedamasukattoMCSR-448MCSR44857mcsr00448
    • 2021-09-04
    101 min

    [SQTE-380]Honor S*****t Likes The Face Boys Make When They Feel Good! Mahiro Ichiki

  • mahiro ichiki censoredcreampieschoolgirlSQTEs cutes cute s cuteSQTE-380SQTE380sqte00380
    • 2021-09-17
    118 min

    [MIDE-973]Reversal! Fumika The Investigator Who Keeps Getting Fucked By Bad Guys Fumika Nakayama

  • nakayama fumika censoredbig titssquirtingMIDEmoodyzkyouseimoodyz divaMIDE-973MIDE973mide00973
    • 2021-10-02
    139 min

    [MMUS-057]Small, Devilish And Provocative Beautiful Girl - Ena Satsuki

  • ena satsuki censoredbeautiful girlslutMMUSmarrionkasai kijinkcpMMUS-057MMUS057mmus00057
    • 2021-10-09
    138 min

    [CEAD-370]Ema Kuon"s One Off Adult Debut: Her First Time Experiencing Total Climax And Trembling From A Massive Cock!

  • emma kuon censoredblowjobmature womanCEADserebu no tomoCEAD-370CEAD370cead00370
    • 2021-10-14
    116 min

    [TOEN-051]Naomi Miura, 49 Years Old - First Time Shots E-cup Plump Married Woman AV Debut!

  • naomi miura censoredcreampiemarried womanTOENcenter villagefusuketaoyuanTOEN-051TOEN051h-086toen00051
    • 2021-11-14
    98 min

    390JNT-030 [I Want To Spear Every Day, Strike Beauty] Immediate Appointment With A Slender Beauty Who Is Cute In The Super Idol Class! !! Get Married Normally! !! Yoshiko-Chan, Who Is Inevitably In Love With Her, Has Super Erotic Sex! !! Sensitive Bo

  • amateur censoredcreampiesquirtingjntjnt-030jnt030390jnt-030
    • 2021-11-25
    109 min

    YAHO-022 Macaron (Narumi Hirose)

  • amateur censoredcreampiesquirtingyahoyaho-022yaho022yaho-022
    • 2021-11-26
    62 min

    300NTK-664 [Yodare Beauty Big Tits] [Beauty Complete Awakening] [Disturbance Gonzo 2nn] The Mouth On Kimatte Is Also Drooling And The Mouth Underneath Is Really Wet! !! Beautiful Big Breasts Swaying And Swaying De Nasty Nature Release Whitening Mochi

  • amateur censoredcreampiesquirtingntkntk-664ntk664300ntk-664
    • 2021-11-27
    40 min

    H0930 ki211128 Chisato Miura 40years old

  • amateur uncensoredh0930
    • 2021-12-22
    74 min

    259LUXU-1507 Luxury TV 1499 A Slender Older Sister Who Handles Race Queens And Underwear Models Is Here! At First, While Being Nervous, He Gradually Becomes Bold From A Thick Kiss, And In Proportion To That, The Secret Part Is Wet With Love Juice. Th

  • amateur censoredbig titsamateurluxuluxu-1507luxu1507259luxu-1507
    • 2021-12-25
    143 min

    [LZDM-046]Big Tits Of Straight Man Go Crazy With Amazing Technique, Lesbian Fallen Portio Esthetic Sachiko, Nanako Miyamura

  • sachiko nanako miyamura censoredbig titslesbianLZDMlesreultimate ryolezure dramaLZDM-046LZDM046lzdm00046
    • 2021-12-31
    118 min

    [VEO-051]A Real Amateur Wife Makes Her Adult Video Debut!! A Real-Life Nursery School Teacher Who Looks Good In A Competitive Swimsuit And Has An Erotic Body With K-Cup 100cm Colossal Tits Hinata Hibino

  • hibino wen censoredcreampiebig titsVEOvenuskaniebornVEO-051VEO051veo00051
    • 2022-01-07
    203 min

    [HUNTB-177]We Don"t Have Anything To Do After School, So We Always End Up Meeting Together At My Guest House For Casual Sex With Someone. I"ve Transferred To A School Out In The Country, And I"m The Only Male S*****t..

  • censoredcreampieschoolgirlHUNTBhunterkawajirihhh groupHUNTB-177HUNTB177huntb00177
    • 2022-01-18
    59 min

    [011822-001]Challenge Maki Koizumi

  • maki koizumi uncensoredcreampiehandjobcaribbeancom
    • 2022-01-22
    57 min

    Pacopacomama 012122_597 First Document By Amateur Wife, 97: Yukari Sato

  • amateur uncensoredpacopacomama
    • 2022-01-29
    127 min

    [KTKC-135]The First Fan Appreciation Nude Shooting Festival Of The Hottest NG Bursting Tits Cooking Tutor Leaked Video Ram (H Cup/College S*****t)

  • censoredcreampiebig titsKTKCkichikkusu mousou zokukourogi tasukekyonyuuKTKC-135KTKC135ktkc00135
    • 2022-01-31
    46 min

    292MY-542 Riko Akagi 2

  • amateur censoredmarried womanamateurmymy-542my542292my-542
    • 2022-02-12
    31 min

    FC2PPV 2660608 First Shot! !! Limited Number! [Uncensored] Holiday Date With A Nurse At A Veterinary Hospital Who Keeps A Pure Heart … When You Enter The Room, You Suddenly Change And Cum Inside Twice For The Overflowing Sexual Desire That You U

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored