emmanuel censored jav documentary javcensored




FC2GMEMAMBIGVHNACRDTTNACXHZGDNNPJDASDRBDHDKAAVSASSISPPPDSTARSSQTEMVSDAPODAUKGJUFE

2020-11-19
121 min

[BBTU-001]Titty Job From A Cock Whisperer This Big Tits ASMR Babe Will Melt Your Fucking Mind Nanami Matsumoto

  • nana matsumoto censoredslutsingle workBBTUdogmatenunmy big titsBBTU-001BBTU001bbtu00001
    • 2020-11-22
    117 min

    [CAWD-140]Breaking In Niece: I Want My Beloved Niece To Be Exclusively Mine... Jealous Uncle Makes Niece His Very Own Fuck Toy - Moko Sakura

  • sakura moko censoredcreampiebeautiful girlCAWDkawaiitake dCAWD-140CAWD140cawd00140
    • 2020-11-27
    51 min

    [SHYN-133]SOD Female Employees - Strip Rock-Paper-Scissors - Surprised While Setting Up For A Meeting! Executive Division Yui Asamoto

  • yui asamoto censoredbeautiful girlSHYNsod createy 10432sod female employeeSHYN-133SHYN1331shyn00133
    • 2020-11-28
    143 min

    [JKSR-470]10 AM At School, What's Up... Chiharu Chiharu Sakurai

  • chiharu sakurai censoredcreampieuniformJKSRbig morkalobockeyprink junkyJKSR-470JKSR47057jksr00470
    • 2020-12-05
    240 min

    [HUNTA-902]"Sorry For Making Such A Mess!" Submissive Maid Squirts All Over The Place And Gets The Entire Room Wet As She Keeps Cumming! Then I Make Her Apologize, Clean The Floor And Lick My Feet As I Cum Inside Her Again And Again!

  • censoredsquirtingHUNTAhunterkawajirihhh groupHUNTA-902HUNTA902hunta00902
    • 2020-12-12
    152 min

    [DASD-772]My Stepsisters Seduced Me By Rubbing Their Lotion-Slathered Big Tits. Ruka Inaba Rika Tsubaki

  • inaba tsubaki rika censoredbig titssisterDASDdasrokusaburo mishimaDASD-772DASD772dasd00772
    • 2021-01-05
    132 min

    [STARS-315]I Met My C***dhood Friend For The First Time In 10 Years, And She Turned The Tables On Me And Hit Me With Out-Of-Control Bucking Bronco Sex Ichika Nagano

  • ichika nagano censoredcreampiesingle workSTARSsod createnorihito hondaSTARS-315STARS3151stars00315
    • 2021-01-06
    66 min

    [sika-020]あい＆あずき

  • amateur censoredcreampiebig titssikasika-020sika020sika-020
    • 2021-01-19
    62 min

    HEYZO 2443 Orgasms With A Horny Pussy Girl Vol.11 – Kana Takashima

  • kana takashima uncensoredcreampieheyzo
    • 2021-01-28
    112 min

    [SPRD-1369]Yours Is Way Better Than My Husband's... Sayako Sanada

  • sanada sanako censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1369SPRD136918sprd01369
    • 2021-02-06
    110 min

    [LLAN-002]A College Girl. And I'm A Virgin. How It Feels For The First Time... How Does It Feel To Be Rocked By These Emotions For The First Time... I Think, That I Prefer Women... June Lovejoy Mikuni Akane

  • june lovejoy mikuni zhu censoredlesbianLLANvivianlilianLLAN-002LLAN002llan00002
    • 2021-02-08
    62 min

    FC2PPV 1676178 [No] A cute 18-year-old demon with a minimum body suddenly cums into a pussy that blew the tide for the first time

  • amateur uncensoredfc2
    • 2021-02-10
    80 min

    [ETQR-195][Daydream POV] Skipping Work To Have Sex On The Clock With That Cute Coworker In Hotel Room - Ms. Tojo, 24

  • censoredcreampieuniformETQRerotic timeETQR-195ETQR195h-1186etqr00195
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-11
    120 min

    [JRZE-028]First Time Filming My Affair Satomi Sometani

  • satomi someya censoredcreampiemature womanJRZEcenter villagekotaro misatojurakuJRZE-028JRZE028h-086jrze00028
    • 2021-02-15
    150 min

    [WA-449]I Was Pussy Grinding My MILF Stepmama When She Said, "Oh! Your Rock Hard Cock Slipped Inside Me!" But It Felt So Good We Just Kept On Going In The Raw! 2

  • censoredmilfmature womanWAlotusWA-449WA449h-047wa00449
    • 2021-03-11
    118 min

    [HBAD-577]My Step Sister's Sex Drive Is So Uncontrollable That No One Is Safe Miu Narumi

  • narumi miu censoredHBADhibinorokutani masafumibabeHBAD-577HBAD5771hbad00577
    • 2021-03-13
    119 min

    [MEYD-661]The Truth Is, I've Been Continuously Fucked By My Husband's Boss ... Kanon Amane

  • natural kanon censoredcreampiesingle workMEYDtameike gorodai omuraMEYD-661MEYD661meyd00661
    • 2021-03-17
    92 min

    428SUKE-065 [Dense copulation with a sweet-hearted cat girl] Borrow a mobile battery and pacopaco SP with a girl who loves cats! !! A big meal at a cat cafe! "I want to spoil" Play flirting toys at the hotel! Thorough copulation with a lasciv

  • amateur censoredcreampiebig titssukesuke-065suke065428suke-065
    • 2021-03-18
    120 min

    [C-2622]Day Trip Spa Mature Woman Lust Trip #018

  • aikawa kyouko censoredmarried womanmature womanCgogoskoichi takahashicore gogo sC-2622C2622
    • 2021-04-15
    41 min

    FC2PPV 1770970 [Personal shooting] ♀ 250 Reading More ◯ -chan 18 years old 8th time Creampie sex with a popular transcendental beautiful girl Saffle who continues until she gets pregnant!

  • amateur uncensoredfc2
    • 2021-04-15
    60 min

    FCP-012 [Delivery only] "What did you do？ you can not sleep？ I’ll do something comfortable and let you lie down … ”Ultimate healing erotic! Co-sleeping handjob! !! ＃ 3

  • amateur censoredbig titsamateurfcpfcp-012fcp012fcp-012
    • 2021-04-18
    126 min

    [APNS-238]Stepsister Swap - How To Wreck A Family Mitsuha Higuchi Sumire Kurokawa

  • mitsuha higuchi sumire kurokawa censoredcreampiedramaAPNSaurora project annexyukihiro nasuaurora project anexAPNS-238APNS238apns00238
    • 2021-05-14
    106 min

    [ROYD-055]I Woke Up To Find A Gorgeous Tanned Half-Japanese Slut Resting Beside Me! We Fucked Last Night？! Oh No! I Don't Remember A Thing! Except She Seems To Want To Pick Up Where We Left Off... Remon Sawa

  • sawa lemon censoredcreampiebig titsROYDroyalcognac kaminohhh groupROYD-055ROYD055royd00055
    • 2021-05-18
    69 min

    FC2PPV 1824141 [Limited video] TwitCasting huge breasts K ③ Rhythmic gymnastics club completely fell into an unequaled penis, too young erotic soft body & Gonzo outflow that spree acme while squeezing a huge breasts pussy personal shooting

  • amateur uncensoredfc2
    • 2021-05-29
    92 min

    [VENX-041]My Big Tits Sister-In-Law Is Luring Me To Temptation With Her Titties - I Was Dumped By My Girlfriend, And My Sexy And Kind Big Titty Big Sister-In-Law Was Trying To Cheer Me Up (But The Truth Was That She Was Just Horny Because She Hadn�

  • airi momose censoredcreampiebig titsVENXvenuskaniefakecest winntersVENX-041VENX041venx00041
    • 2021-06-05
    60 min

    Pacopacomama 060521_486 Mature Lady Piledriver Position BJ : Mari Onodera

  • amateur uncensoredpacopacomama
    • 2021-07-09
    240 min

    [KRU-123]Great Collection of Pristine Cute Girls! Check Out the Bodies of Beautiful Y********ls in Uniform.

  • censoredbeautiful girlKRUkarmagroupKRU-123KRU123kru00123
    • 2021-07-17
    190 min

    [JUL-647]She Turns Into A Completely Different Person With A Cock Inside Her. 34 Years Old, Married, And Cock-Crazed Saori Nagashima Makes Her AV Debut.

  • nagashima saori censoredmarried womanmature womanJULmadonnamamezawa mametaroJUL-647JUL647jul00647
    • 2021-07-20
    186 min

    [SDNM-291]I Want To Repeatedly Experience The Wonderful Smile Of This Soothing Massage Parlor Therapist Yuhi Izumi 33 Years Old The Final Chapter She Was Unable To Suppress Her Desires, And Now She's Having Her First And Final Fuck With Another M

  • izumi freezing censoredcreampiebig titsSDNMsod createzaku araigenuine married woman the porn experienSDNM-291SDNM2911sdnm00291
    • 2021-07-29
    120 min

    [SGA-149]最高の愛人と、最高の中出し性交。 63 GカップむっつりOL

  • amateur censoredcreampiebig titssgasga-149sga149sga-149
    • 2021-08-12
    206 min

    [NHDTB-562]Miniskirt High School Groping, Fucked From Behind With Her Short Skirt Turned Up

  • censoredNHDTBnatural highsakurai vanillaNHDTB-562NHDTB5621nhdtb00562
    • 2021-08-12
    223 min

    [DANDY-774]Mature Massage Parlor Therapist With Big Tits Shakes Curvy Ass Doing Cowgirl On A Guy"s Hard-on While He"s Completely Locked Down

  • kimishima mio honami akagi censoredbig titsslutDANDYdandytanaka baconDANDY-774DANDY7741dandy00774
    • 2021-09-02
    32 min

    FC2PPV 2129074 [New Work, Half Price! ] ♀ 324 Female College Student Ri ◯ -Chan 20 Years Old 1st Time A Tall Slender Beauty Makes Her Av Debut With A Genuine Vaginal Cum Shot Prepared For Pregnancy With A Complete Appearance That Is Open To The World

  • amateur uncensoredfc2
    • 2021-09-03
    151 min

    [MIDE-965]Squirting Cervical Orgasm Activation By Piston Fucking, Starring Nana Yagi

  • nana yagi censoredsquirtingblowjobMIDEmoodyzdoragon nishikawamoodyz divaMIDE-965MIDE965mide00965
    • 2021-09-09
    110 min

    [GS-403]When I Scribbled That I Was Looking For A Sex Friend In A Public Toilet, A Girl Who Loves Sucking On Cocks And Giving Blowjobs Came!! She Contacted Me, So I Waited In The Toilet. Then, This Girl Came In Without Any Panties And Her Pubic Hair

  • censoredschoolgirlGSsosoru x garconred ballGS-403GS403h-101gs00403
    • 2021-09-10
    122 min

    [RKI-618]All New Bucketloads Of Bukkake Minami Hatsukawa

  • hatsukawa minami censoredcreampiebeautiful girlRKIrookieRKI-618RKI618rki00618
    • 2021-09-11
    100 min

    [XRL-022]Race Queen Applicant Training Course: Dad"s Interview - Trainer Aoi Nakashiro

  • nakagusuku censoredcosplaysingle workXRLk m producereal real worksXRL-022XRL022xrl00022
    • 2021-09-11
    114 min

    [BABM-003]The Doting Step-Mom Ena Makes Me Feel Loved And Takes Care Of Me And When I Cry She Spoils Me With Sex Ena Koume

  • ena koume censoredcreampiebig titsBABMkaguya hime pt mousozokuyumesaki ichiroubabubabu no jitsuBABM-003BABM003babm00003
    • 2021-09-15
    132 min

    [GVH-288]Naughty Nurses - Honoka Tsujii

  • tsujii honoka censoredcreampiegrandfatherGVHglory questtakahashi chitsujiGVH-288GVH288gvh00288
    • 2021-09-17
    69 min

    230OREC-878 Non

  • amateur censoredcreampieamateurorecorec-878orec878230orec-878
    • 2021-09-24
    125 min

    [ZKWD-018]The After-School Human Toilet #18 Aya Sakai

  • ayami sakai censoredcreampiesingle workZKWDtoyohikozarakiyasushiun kaiZKWD-018ZKWD018zkwd00018
    • 2021-09-25
    131 min

    [LZPL-060]Tongue Heavy Lesbian Kissing Sex, Lewd Lesbian Full Body Drooling. Yumi Saeki ka, Reira Kuon

  • yuka saeki leira haduki censoredlesbianslutLZPLlez reflagmanlez re playLZPL-060LZPL060lzpl00060
    • 2021-09-26
    115 min

    [083PPP-2245]ヤリマンギャル大集合！バイブスぶちあげ成人式でスッポンポンポーッン！ 完全版 空海 加賀美まり

  • amateur censoredamateurpppppp-2245ppp2245083ppp-2245
    • 2021-09-27
    76 min

    259LUXU-1483 Luxury TV 1462 A Beauty Registered Dietitian Who Says He Lost Love Because Of His Affair Appeared. She Looks Nervous About Having Sex With The Man She Met For The First Time, But Her Body Reacts Sensitively As She Begins To Ripen As An A

  • amateur censoredamateurluxuluxu-1483luxu1483259luxu-1483
    • 2021-10-01
    77 min

    259LUXU-1481 Luxury TV 1464 Big Breasts President’s Daughter Appears For The First Time In AV! The Beautiful Bust And Plump Body That Shakes Every Time It Is Pistoned Is Obscene! Adult Sex With A Gap Between The Innocent Looks And The Glamorous

  • amateur censoredbig titsamateurluxuluxu-1481luxu1481259luxu-1481
    • 2021-10-09
    120 min

    [BAAM-004]Lining Up the Gals Like Beads on a String. A Gal who is a Petite, Beautiful Girl, Ruru-chan.

  • censoredamateurBAAMbarutanyurukoamazonessBAAM-004BAAM004baam00004
    • 2021-10-13
    45 min

    229SCUTE-1139 Mao (20) S-Cute Saddle Tide Can’t Stand Big Tits Girl’s Nasty H (Mao Hamasaki)

  • amateur censoredcreampiesquirtingscutescute-1139scute1139229scute-1139
    • 2021-10-15
    56 min

    FC2PPV 2345920 * Until 10/17 3980⇒2980 ★ First Shot ☆ Small Breasts Slender Beauty ♥ Cool Beauty Manyi-Chan 22 Years Old ☆ Man Juice Cod To Blame Electric Massage! ♥ Cool But The Dick Is Wet And Wet Lust Cum Shot Ejaculation ♥ * With Benefits

  • amateur uncensoredfc2
    • 2021-10-21
    125 min

    [JURA-043]Wife Mitabi, First Time in Her 50s. Reiko Seo

  • reiko seo censoredcreampiemarried womanJURAcenter villagesouthern earthjurakuJURA-043JURA043h-086jura00043
    • 2021-11-02
    60 min

    1Pondo 110221_001 Hustle Time With A Sexy Girl : Rena

  • amateur uncensored1pondo
    • 2021-11-21
    82 min

    345SIMM-678 [101cm J Cup! Kansai Dialect Beauty Huge Breasts J ○! ] Even Though It’s Huge Breasts, It Doesn’t Hang Down At All! Uncle And Icharab Sex While Shaking The Non-Standard Beautiful Huge Breasts Against Gravity With Balun Balun ♪!

  • amateur censoredcreampiebig titssimmsimm-678simm678345simm-678
    • 2021-12-02
    238 min

    [STSK-005]Going Undercover To A Physical J* Uniform Reflexology Salon An All Peeping Expose Of The Truth Behind Their Secret Optional Services *4 Girls On Film*

  • censoredcreampieuniformSTSKshirouto 39STSK-005STSK005h-1605stsk00005
    • 2021-12-04
    130 min

    [GVH-324]Titty-Loving Shota-kun"s Lewd Prank Hana Himesaki

  • himesaki hana censoredbig titsschoolgirlGVHglory questtakahashi chitsujiGVH-324GVH324gvh00324
    • 2022-01-07
    55 min

    230OREC-979 Nanase (Nanase Ogura)

  • amateur censoredcreampieamateurorecorec-979orec979230orec-979
    • 2022-01-09
    66 min

    383MONA-004 Sensitive Dirty Little Black Niso Girl Kurumi-Chan

  • amateur censoredcreampieamateurmonamona-004mona004383mona-004



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored