fa pro




FC2DASDFSDSSRBDSTARSCHRVNACRSDABEBODMIDVSSISAUKGNGODCAWDMEYDMIDECESDVEMAPREDMVSDAUKS

2020-11-01
119 min

[JKNK-114]If You Suddenly Show Off To A Married Woman In The Middle Of Shopping...

  • censoredmature womanJKNKjuku no kura emmanuellejuku no kuraJKNK-114JKNK114jknk00114
    • 2020-11-07
    48 min

    FC2PPV 1561313 [Individual shooting] I reached out to my friend’s daughter and found out that she was pregnant! Still can not stop raw paco vaginal cum shot! [Appearance]

  • amateur uncensoredfc2
    • 2020-11-09
    37 min

    FC2PPV 1563958 Big breasts single mother and second secret meeting ♥ 1 gonzo before picking up your child (laughs) Gonzo with mom who is more erotic than last time ♪ * High quality version & review benefits included ♪ [Personal shooting / origina

  • amateur uncensoredfc2
    • 2020-11-19
    109 min

    [OBD-068]This Ass Princess Is Actually A Grandmother - Emi Enda

  • emi toda censoredmature womanOBDrubysukeroku katouOBD-068OBD068obd00068
    • 2020-11-27
    122 min

    [CPDE-044]The Strongest And Most Exclusive 44 Urara Kanon

  • hanaoto urara censoredcreampiecosplayCPDEprestigecp den enher strongest attributeCPDE-044CPDE044118cpde00044
    • 2020-11-28
    117 min

    [MIDE-851]Famous Former C***d Actor With H-Cup Tits Has Nonstop Orgasms At Her Titty Brothel Residency Fumika Nakayama

  • nakayama fumika censoredbig titsslutMIDEmoodyzdragon nishikawamoodyz divaMIDE-851MIDE851mide00851
    • 2020-12-02
    49 min

    FC2PPV 1592151 ■ Limited to 3 days ■ 27-year-old boyfriend. An adult girl who is a cosmetics salesperson loses her sexual desire because her sexlessness is too long and she has a forbidden big flirtation. “The theory that an ordinary woman who s

  • amateur uncensoredfc2
    • 2020-12-07
    61 min

    FC2PPV 1598107 ☆ First shot ☆ Complete appearance ☆ Outstanding style ♥ Black hair loli 19-year-old Japanese girl ♥ Fair-skinned slender body & plenty of shaved beauty man cum shot ♥ [With benefits]

  • amateur uncensoredfc2
    • 2020-12-17
    147 min

    [BLK-482]Got Ourselves A Still Active Slutty MILF! Her Tanned Body Still Looks The Same As In Her Teens And Is Sure To Turn You On! Even Though She Has A Husband She Keeps Inviting Other Men's Dicks To The Party In Her Pussy! REMI

  • remi censoredbig titssingle workBLKkira kirakira kira black galBLK-482BLK482blk00482
    • 2020-12-18
    129 min

    [BDA-131]Finally Ready For A Black Man - Ravaged By Enormous Cocks Kanon Nakajo

  • nakajo canon censoredcreampiedeepthroatBDAbermuda mousouzokuichikan abashiriBDA-131BDA131bda00131
    • 2020-12-25
    56 min

    FC2PPV 1620164 [First time limited 1980] Serious beautiful wife who usually works at Su ○○ station ❤️ Actually it was sexless for 6 years ❤️ A married woman who is hungry for libido is rolled up with an electric massage machine, a vibrator and anothe

  • amateur uncensoredfc2
    • 2021-01-09
    164 min

    [MIDE-868]Orgasmic Spasms 4 SEX Rei Futami

  • rei futami censoredsquirtingbeautiful girlMIDEmoodyztake dmoodyz divaMIDE-868MIDE868mide00868
    • 2021-01-09
    72 min

    FC2PPV 1638512 Idol-class beautiful girl Miyu-chan begins to princess! Let’s strip off the cute kimono and put out a lot of dangerous days early in the new year! Cum too! [Multiple benefits available] [No individual shooting]

  • amateur uncensoredfc2
    • 2021-01-10
    57 min

    FC2PPV 1639088 [Uncensored / No Mo] Buyer review benefits available (high-quality version) _ [It’s not bad to take it off] Chisato / 24 years old / OL [Complete appearance] Clothed raw squirrel cum shot SEX

  • amateur uncensoredfc2
    • 2021-01-17
    129 min

    [BDA-132]Black Guys Unleashed! Big Black Rod - Yuka Hirose

  • yuka hirose censoredcreampiedeepthroatBDAbermuda mousouzokuichikan abashiriBDA-132BDA132bda00132
    • 2021-01-18
    47 min

    FC2PPV 1650265 [No] A slender black-haired beautiful girl. She played with her unclean body

  • amateur uncensoredfc2
    • 2021-01-19
    29 min

    FC2PPV 1651181 The 3rd edition of Mai-chan, a beautiful girl! Last before holidays! The long-awaited cosplay work! Blow and bounce from without a blow job and cum inside! The last is a surprising flood squirting!

  • amateur uncensoredfc2
    • 2021-01-20
    240 min

    [YVG-025]Big Titted Bath: A Sexual Experience With A Big Breasted Woman In A Bath

  • censoredbig titsblowjobYVGglory questYVG-025YVG02513yvg00025
    • 2021-02-05
    140 min

    [SKSK-044]This Pay-For-Play J* Is Wearing See-Thru Black Pantyhose And Participating In Private Video Session Minon Has Beautiful Legs And She's Got A Soft Pussy And Will Cum Instantly & Yume, Who's Got Pink Nipples And Will Scream And Sho

  • natsuki yume aisu minon censoredcreampiebig titsSKSKprestigesukesukeSKSK-044SKSK044118sksk00044
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    92 min

    [YMDS-019]A Big Dick Man (Big, As In, Like A Bamboo Sword) Who Won't Do A Thing While You Rent Him The Client: Mao A Secretly Sexual Monster With Marshmallow-Soft G-Cup Titties And A Voluptuously Beautiful Ass

  • censoredblowjobslutYMDSmomotaro video publishingdukeyoung peachYMDS-019YMDS019ymds00019
    • 2021-02-12
    65 min

    [DHT-243]Please Introduce Me To Someone Hornier Than You! 4 A Horny Bitch's Friend Has To Be A Horny Slut Too! Anyone Can Agree, These Girls Are The Sure Thing, Guaranteed To Be A Great Fuck, No Matter How Many Times They Fuck, So Here We Are, Fu

  • censoredbig titssquirtingDHThot entertainmentyen ikkiDHT-243DHT24359dht00243
    • 2021-02-23
    45 min

    FC2PPV 1699005 ★ Amateur appearance ☆ Continuous angry waves 3P orgy ♥ Beauty BODY Chie-san re-advent! ☆ Excited about the first 3P ♥ Belovero W Blow ♥ Fierce! Continuous Iki ♥ Bottomless Libido Continuous Creampie Ejaculation ♥ [Personal Shooting] *

  • amateur uncensoredfc2
    • 2021-03-03
    240 min

    [RVH-007]Girls Possessed By Exhibitionist/G*******g/Bukkake Desires Best Hits Collection vol. 1

  • yano tsubasa rin kosaka censoredslutbukkakeRVHglory questRVH-007RVH00713rvh00007
    • 2021-03-05
    106 min

    [SCR-266]Peeping Amateur Masturbation Videos Targeting Only Female Guests At A City Hotel

  • censoredamateurSCRglay zs crimeSCR-266SCR26612scr00266
    • 2021-03-16
    125 min

    [MXGS-1177]Maid Membership ~ Ordering A Home Maid That You Have To Reserve Three Months In Advance... Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiebeautiful girlMXGSmaxingMXGS-1177MXGS1177h-068mxgs01177
    • 2021-04-01
    239 min

    [MGR-2102]An All-Japan Sex Tour 4 Hours Kobe/Gotenba/Omiya/Chiba/Hakodate/Tokyo (Akasaka And Ikebukuro) We Had Lots Of Sex With Sexy And Cute Amateur Girls!

  • censoredamateurMGRtm createmomojirimangoMGR-2102MGR2102165mgr02102
    • 2021-04-08
    53 min

    FC2PPV 1760262 [Individual shooting appearance] No63 Yuna-chan 18 years old J system graduation commemoration! A virgin with zero male experience can not stand the toys and ejects a lot

  • amateur uncensoredfc2
    • 2021-04-12
    125 min

    [GMBM-002]Fantasy Explosion I Don't Know Where To Look When My Step Sister Walks Around In Front Of Me Naked! Hana Haruna

  • haruna hana censoredcreampiebig titsGMBMmercurybirdman teppeinaked familyGMBM-002GMBM002h-1133gmbm00002
    • 2021-04-15
    220 min

    [NASH-495]A Local Wife Fucked Like In A Japanese Artistic Romance Paperback - Yume Hakuchu 3

  • censoredbig titsmature womanNASHpinkshinryu takeshinadeshikoNASH-495NASH495nash00495
    • 2021-05-14
    149 min

    [DVDMS-669]Having A Quickie With The Fair-Skinned Big-Assed Cleaning Woman! She Loved My Big Dick So Much She Came Back The Next Day For More 4

  • censoredcreampiebig titsDVDMSdeep sswing nagaseDVDMS-669DVDMS669dvdms00669
    • 2021-05-15
    85 min

    FC2PPV 1818471 [Limited to the first 100 people, 1000 yen off] Riho 19 years old (3), raw, facial cumshot "I want to get married because I want to leave the house". C Put a tinco on the black hair of the student face. Wash a large amount of w

  • amateur uncensoredfc2
    • 2021-06-04
    118 min

    [ATID-466]BBP Female Detective Falls In Love With Big Black Penis Kaho Imai

  • natsuho imai censoredsingle workATIDattackerseitaro hagaein madATID-466ATID466atid00466
    • 2021-06-11
    45 min

    HEYZO 2563 Circle Of Sex-holic Pornstars -Jyun Mamiya- Vol.2 – Jyun Mamiya

  • jyun mamiya uncensoredheyzo
    • 2021-06-11
    122 min

    [EBOD-834]Shocking Revival - Miyuki Arisaka's Ultra-Slim Busty Body Is Pushed To The Limit With The Ultimate Simultaneous Creampie Orgasms

  • arisaka miyuki censoredcreampiebig titsEBODe bodymichiru arashiyamaEBOD-834EBOD834ebod00834
    • 2021-06-11
    60 min

    383REIW-072 Sumire

  • amateur censoredamateurslutreiwreiw-072reiw072383reiw-072
    • 2021-06-15
    116 min

    [KIRE-041]Celebrity Yume Nanase AV DEBUT

  • nanase yume censoredsingle workKIREsod createnao masakibeauty kirei sodKIRE-041KIRE0411kire00041
    • 2021-06-20
    120 min

    [NXG-363]What To Do About A Female Thief？ Three Years Worth Of Records At A Certain Market

  • censoredcreampieamateurNXGstar paradisenext groupNXG-363NXG363h-254nxg00363
    • 2021-06-26
    119 min

    [AUKG-515]Lesbian Sub Training - Kinky Roommate Loves To Tease - Miyabi Yurikawa Shion Nagisawa

  • yurikawa masa nagisawa shion censoredlesbianslutAUKGu krentoAUKG-515AUKG515aukg00515
    • 2021-07-03
    126 min

    [PKPD-150]Sugar Baby: Age 18, Creampie OK - Half-In, Half Out Of Fishnet Pantyhose Shion Natsume

  • shion natsume censoredcreampieschoolgirlPKPDfuck group and fun friends daydreamersPKPD-150PKPD150pkpd00150
    • 2021-07-30
    69 min

    [hhsi-007]マオ(25)

  • amateur censoredbig titsamateurhhsihhsi-007hhsi007hhsi-007
    • 2021-08-01
    91 min

    FC2PPV 1950222 Cuckold Post ● I Will Teach You The Secret Way To Make 100 Cute Saffle With A Board! !! Definitely Higher Probability Than Dating ♥♥

  • amateur uncensoredfc2
    • 2021-08-12
    206 min

    [NHDTB-562]Miniskirt High School Groping, Fucked From Behind With Her Short Skirt Turned Up

  • censoredNHDTBnatural highsakurai vanillaNHDTB-562NHDTB5621nhdtb00562
    • 2021-09-03
    240 min

    [HODV-21608]Return Of The Posting A-Team - Plenty Of Lewds From Ultra-Slutty Amateur Hotties Special Feature, 4 Hours

  • censoredcosplayHODVh m pHODV-21608HODV216085642hodv21608
    • 2021-09-04
    71 min

    200GANA-2548 Seriously Nampa, First Shot. 1684 If You Were Distributing Uchiwa For Free In Shibuya, You Succeeded In Picking Up A Baby-Faced Beautiful Girl JD! The Delicate Body Is Violently Embraced By The Big Cock Actor And Trembles With Pleasure!

  • amateur censoredamateurganagana-2548gana2548200gana-2548
    • 2021-09-25
    59 min

    521MGFX-022 Excavation ☆ Big Breasts Amateur 19

  • amateur censoredbig titsmarried womanmgfxmgfx-022mgfx022521mgfx-022
    • 2021-10-09
    141 min

    [APAK-201]"My Trip With My Teacher Ended In Lots Of Sex And Giving Him Head Until My Throat Was Sore..." A Hot Springs Vacation With A Submissive S*****t, Starring Atsuko Nakajima

  • atsuko nakajima censoredcreampieschoolgirlAPAKaurora project annexrkAPAK-201APAK201apak00201
    • 2021-11-12
    119 min

    [EBOD-868]E-BODY Has Pursued The Ultimate In Women"s Bodies, And Now, They Present You With The Latest In Camera Technologies To Film A Natural Airhead Megaton J-Cup Titty Babe With A Voluptuous Body High Definition Video The Ultimate Female Body

  • kisaki alice censoredbig titsblowjobEBODe bodyarashiyama michiruEBOD-868EBOD868ebod00868
    • 2021-11-28
    62 min

    SIRO-4677 [First Shot] [Tall x Beautiful Legs] [Sensitive Constitution Despite Being Innocent] Excavation Of A Shy Active Jd With A Sensitive Body That Is Easy To Feel. Although It Is Embarrassing, It Makes Me Feel Good, And The Beautiful Body Writhe

  • amateur censoredamateursirosiro-4677siro4677siro-4677
    • 2021-12-02
    61 min

    SIRO-4713 [First Shot] [Neat And Clean Girls] [Cum With A Slamming Back] A Slender Apparel Clerk Full Of Graceful Appearance. She Shakes Her Delicate Body In Small Steps And Reveals Her Foolery To The Actor’s Relentless Blame. AV Application On

  • amateur censoredamateursirosiro-4713siro4713siro-4713
    • 2021-12-14
    58 min

    [HEYZO-2678]Akemi Kihara New Soapland Whore"s Quick Suck And Creampie!

  • akemi kihara uncensoredcreampieheyzo
    • 2021-12-20
    71 min

    383REIW-104 Koa (Amane Love)

  • amateur censoredcreampiebig titsreiwreiw-104reiw104383reiw-104
    • 2022-01-29
    127 min

    [KTKC-135]The First Fan Appreciation Nude Shooting Festival Of The Hottest NG Bursting Tits Cooking Tutor Leaked Video Ram (H Cup/College S*****t)

  • censoredcreampiebig titsKTKCkichikkusu mousou zokukourogi tasukekyonyuuKTKC-135KTKC135ktkc00135
    • 2022-02-06
    63 min

    SIRO-4782 [First Shot] [Shy Gal] [Sensitive Premature Ejaculation Constitution] A Gal Hairdresser Who Has A Maiden Look In Spite Of Her Flashy Appearance. She Blushes Her Cheeks With A Word Blame, But Wets Her Secret Part And Cums Continuously On A H

  • amateur censoredamateursirosiro-4782siro4782siro-4782
    • 2022-02-17
    73 min

    [REBD-626]Amiri, 3. Colorful Glitter. Amiri Saito

  • amiri saito censoredsingle workREBDrebeccataiga kosakaiREBD-626REBD626h-346rebd00626
    • 2022-02-27
    72 min

    200GANA-2640 Seriously Nampa, First Shot. 1764 Picking Up An Apparel Clerk On The Way Home From Work! A Tight Buttocks With A Firm Body! Sensitive Oma ● Ko Is Stimulated And Repeats Alive! (Manami Haruno)

  • amateur censoredamateurganagana-2640gana2640200gana-2640



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored