falenotube




FC2IPXMARASTARSMIDVKBIVENUBBANNATRMVSDSSISSHKDPPPDSQTEVEMASANJULKSBJAUKGCJODHND

2020-11-19
240 min

[PAP-204]You'd Never Guess Their Age! Freakishly Good-Looking Mature Beauties With Amazing Bodies Who Love To Fuck Japanese Guys - Sex With Blonde-Haired MILFs 4 Hours 9 Girls

  • censoredmature womanPAPrubyjukunenPAP-204PAP204pap00204
    • 2020-11-20
    65 min

    FC2PPV 1577108 “Oh no, it feels good! I’m going to go back again !!” A god-style beautiful wife who is too sensitive is squirted many times with toys and meat sticks!

  • amateur uncensoredfc2
    • 2020-11-28
    172 min

    [CLUB-621]We Seduced Only Big Tits Sexy Cosplayer Babes With Estimated Titty Sizes Of G-Cup Or Bigger And Brought Them Home For Some Hidden Camera Fun. When We Teased Them By Flashing Our Rock Hard Cocks At Them, They Got Hot And Horny And Gave Us Al

  • censoredbig titscosplayCLUBhentai shinshi clubCLUB-621CLUB621club00621
    • 2020-12-04
    73 min

    [KYUN-003][Streaming Only] # Kyun 003 / Suzu / 19 Years Old / Vocational School S*****t

  • censoredcreampiebig titsKYUNprestigekyunKYUN-003KYUN003118kyun00003
    • 2020-12-05
    119 min

    [ADN-277]I Could Not Resist Her Defenseless Body: Crossing The Line With The Girl Next Door From My C***dhood--My Sister-In-Law. Tsumugi Akari

  • akari tsumugi censoredsingle workdramaADNattackerskitorune kawaguchiotona no dramaADN-277ADN277adn00277
    • 2020-12-08
    63 min

    438PVMK-008 Ren 2

  • amateur censoredcreampieamateurpvmkpvmk-008pvmk008pvmk-008
    • 2020-12-25
    124 min

    [DFDM-019]Loving Babe Whispers Dirty Talk Into Your Ear While She Teases Your Nipples... Hazuki Wakamiya

  • wakamiya censoredbig titsslutDFDMwaap entertainmenteightfearlessDFDM-019DFDM0192dfdm00019
    • 2020-12-27
    169 min

    [MDVHJ-027]Widow Fucked In Front Of Her Deceased Husband

  • riho yuki hotaru mori censoredcreampiemature womanMDVHJgraffiti japanmovieMDVHJ-027MDVHJ02748mdvhj00027
    • 2021-01-08
    58 min

    FC2PPV 1636900 ★ Premier first shot amateur ☆ Idol defeat ♥ Overwhelming beautiful girl Naho 20 years old ☆ Impressed by beautiful small breasts slender BODY ♥ Excited for the first transformation play ♥ Raw vaginal cum shot to beautiful man ♥ [Perso

  • amateur uncensoredfc2
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-16
    146 min

    [JMTY-042]First Time Shots - Mugi-chan

  • censoredJMTYteacher delusion groupJMTY-042JMTY042jmty00042
    • 2021-01-31
    131 min

    [EMBZ-220]Married Amateur Girls Cover Their Feet For One Whole Day So That You Can Savor Their Fragrant Pantyhose...

  • asano honoka sakamoto censoredmature womanEMBZjukujojuku emmanuellejukujo jukuEMBZ-220EMBZ220embz00220
    • 2021-02-12
    150 min

    [DASD-810]"I'm Jealous, But I'm Getting Hard" She Is Most Beautiful When She Is Fucked By Someone Else. Natsuki

  • censoredamateurbeautiful girlDASDdashiromichi hoseDASD-810DASD810dasd00810
    • 2021-02-22
    80 min

    259LUXU-1391 Luxury TV 1369 A beautiful woman with a strong libido who runs a lingerie shop has appeared! The greedy sexual desire that has accumulated in the pool collapses immediately by depositing it with an electric massage machine. In front of m

  • amateur censoredamateurluxuluxu-1391luxu1391259luxu-1391
    • 2021-02-26
    99 min

    504TNNN-002 Yuki-chan

  • amateur censoredbig titsamateurtnnntnnn-002tnnn002504tnnn-002
    • 2021-02-27
    139 min

    [MCSR-426]A Married Woman's Creampie Adultery Vacation - Riho Fujimori

  • riho fujimori censoredcreampiebig titsMCSRbig morkalyumejimascottMCSR-426MCSR42657mcsr00426
    • 2021-03-03
    120 min

    [PFES-020]She's So Naughty She's Nasty - We Found This Voluptuous Back Alley Slut And Secretly Fucked Her Full Of Raw Creampies All Day Long At A Love Hotel

  • censoredcreampiebig titsPFESkira kirasummer panties festivalPFES-020PFES020pfes00020
    • 2021-03-05
    115 min

    [PARATHD-3128][Emergency Live Broadcast] Welcome To The Pussy Hair Photo Studio! Full Version

  • yuuri anne mashiro censoredamateurPARATHDparadise tvPARATHD-3128PARATHD3128parathd03128
    • 2021-03-06
    160 min

    [JUL-494]Teased... Teased... Teased... And Teased Again... Penetrated At The Moment She's Wettest - Adultery With A Soaking Pussy. Nao Jinguji

  • jinguji temple nao censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-494JUL494jul00494
    • 2021-03-06
    477 min

    [OFJE-301]Which Girl Is Your Type？ A Collection Of The Greatest Super Adult Video Idols Who Will Get You Cumming With Just Their Faces, As They Continuously Stare Into Your Eyes, During French Kissing Sex

  • yua mikami nanatsumori riri censoredbig titsbeautiful girlOFJEs1 no 1 styleOFJE-301OFJE301ofje00301
    • 2021-03-12
    218 min

    [SABA-682]New Creampie Raw Footage, S********ls In Uniform Making Money On The Side vol. 005

  • censoredcreampieuniformSABAskyu shirototodoSABA-682SABA682h-244saba00682
    • 2021-03-13
    300 min

    [DVAJ-506]I Creampied My Wife Who Is Obsessed With Her Lover And Hates Me Several Times [Cuckold Revenge] BEST

  • kawakami nanami ai mukai censoredcreampieDVAJalice japansagi kandaDVAJ-506DVAJ506dvaj00506
    • 2021-03-26
    90 min

    300NTK-541 Echi Echi H Cup Sensitive Beauty Is An AV Mania! ？？ Echimuchi busty squeezing promotion body is super binkan! !! A tech co-star who is inevitable to have an AV actor outburst with the total mobilization service of erotic tech unique to man

  • amateur censoredcreampiebig titsntkntk-541ntk541300ntk-541
    • 2021-04-02
    160 min

    [JUL-522]Electric Transfer! Honoka Yonekura Madonna Only Debut! Beautiful Older Woman Loses Herself In A New Pleasure 3 Times

  • hoika yonekura censoredmature womanslutJULmadonnamametaro mamezawaJUL-522JUL522jul00522
    • 2021-04-15
    108 min

    [DDFF-009]A Horny Bunny Slut With Hard Nipples FXXKING BUNNY Himari Kinoshita

  • himari kinoshita himari hanazawa censoredslutsingle workDDFFdogmafk 2DDFF-009DDFF009ddff00009
    • 2021-05-07
    120 min

    [FSDSS-219]Reproductive Bodies Lusting After Each Other Instinctual Sex Complete Unedited Recording Momo Honda

  • honda peach censoredsquirtinglingerieFSDSSfalenokei isoifaleno starFSDSS-219FSDSS2191fsdss00219
    • 2021-06-11
    39 min

    361SEKAO-156 Ash Hollywood from L.A

  • amateur censoredamateursekaosekao-156sekao156361sekao-156
    • 2021-07-05
    74 min

    FC2PPV 1905788 [3980 → Limited number 2980] [Complete appearance] Former crane ○ Flight attendant ❤️ Beautiful wife who looks good with short hair ❤️ Sexless and frustrated ❤️ Shrimp warp bicubic continuous cum ❤️ Massive vaginal cum shot ❤️

  • amateur uncensoredfc2
    • 2021-07-08
    156 min

    [MIST-342]A Private Titty Pub The Pub Suddenly Shut Down When One Of the Girls Called Me, She Said She Was Short On Money, And Wanted To Meet With Me In Private ... So We Kept It A Secret From The Pub, As I Fondled Her Titties And We Had Creampie Sex

  • akari shinmura censoredcreampiebig titsMISTmr michirusaitaMIST-342MIST3421mist00342
    • 2021-07-09
    177 min

    [IPX-682]Hot Kisses and Sweaty Sex with a Pure Beatiful Girl. Kotoyumi Ono.

  • kotoyumi ono censoredblowjobbeautiful girlIPXidea pocketusa pyondishIPX-682IPX682ipx00682
    • 2021-07-17
    55 min

    HEYZO 2568 Thorough Sex With A Sensitive Beautiful MILF Vol.2 – Rena

  • rena uncensoredcreampieheyzo
    • 2021-07-24
    96 min

    390JAC-102 [1 Experienced Person! Ubu Erotic Daughter Gal X Overwhelming Good Looking X Creampie Various 5 Barrage] Woo … Stop! That! Season! In The Ga ~~ Ru! !! !! Summer-Colored Ryoko-Chan! Super Gutsuki Infinite ∞ High Pressure Gal Of Libido!

  • yutuber censoredcreampieamateurjacjac-102jac102390jac-102
    • 2021-08-06
    53 min

    C0930 ki210808 Miharu Kase 19years old

  • amateur uncensoredc0930
    • 2021-08-09
    52 min

    526DHT-0095 22-Year-Old Reckless Girl Kotomi Who Invites A Pick-Up Man To The Room

  • amateur censoredamateurdhtdht-0095dht0095526dht-0095
    • 2021-08-12
    123 min

    [IESP-684]Karen Asahina Lesbians Unleashed - I Fell In Love With My Step-cousin -

  • karen asahina kira rin censoredlesbiandramaIESPie nergykiku riniespIESP-684IESP6841iesp00684
    • 2021-08-20
    160 min

    [DASD-910]Deep Kissing And Hips Swinging, A One Night Hotel Stay Where She Can Show Her True Self: I"m In Heat And Can"t Let Go Of Your Cock Starring Mina Kitano

  • mina kitano censoredcreampiebig titsDASDdasmishima rokusaburoDASD-910DASD910dasd00910
    • 2021-08-28
    60 min

    Pacopacomama 082921_524 Just Keep Fucking This Lady With Natural Hairy Pussy Hiromi Hashimoto

  • amateur uncensoredpacopacomama
    • 2021-08-30
    68 min

    HHSI-009 Rina (Takase Rina)

  • amateur censoredamateurhhsihhsi-009hhsi009hhsi-009
    • 2021-08-30
    45 min

    358WITH-103 Haruna (21) S-Cute With Bath Chopsticks Gonzo H

  • amateur censoredamateurbeautiful girlwithwith-103with103358with-103
    • 2021-09-03
    281 min

    [DVDMS-693]Sex-loving Step-sisters Who Love Raw Sex And Want You To Lick Their Pussies

  • momose asuka mamiya nagi censoredcreampieslutDVDMSdeepsmotofuji peroflavorsDVDMS-693DVDMS693dvdms00693
    • 2021-09-04
    242 min

    [KTKC-123]Anal Fisting The Fisherman"s Daughter 6SEX (Anal Fisting) x 4 hours.

  • censoredcreampiebig titsKTKCkichikkusu mousou zokukyonyuuKTKC-123KTKC123ktkc00123
    • 2021-09-11
    130 min

    [CEMD-054]I Raised A Sexual Relief Doll To Do As I Want, Vol. 5 Yui Hatano

  • yui hatano censoredcreampiemature womanCEMDserebu no tomoCEMD-054CEMD054cemd00054
    • 2021-09-13
    79 min

    SDJ-012 Chika-chan (Ichika Matsumoto)

  • amateur censoredcreampieamateursdjsdj-012sdj012sdj-012
    • 2021-09-29
    65 min

    318LADY-384 Ena / Rikako

  • amateur censoredamateurladylady-384lady384318lady-384
    • 2021-10-01
    120 min

    [MIAA-508]"I"m Not Letting You Go Home Today Store Manager" They Fuck In Secret After The Store Closes And She Made Me Come Over And Over Riho Fujimori

  • riho fujimori censoredcreampiebig titsMIAAmoodyztakarase hironoriminna no kikatanMIAA-508MIAA508miaa00508
    • 2021-10-14
    76 min

    533NNS-013 Underground Idol P Live Outflow Video! !! Masturbation Addicted Plump Nice Ass, Fair-Skinned Beauty Big Tits Soft Body Beautiful Girl Gachi Died! !!

  • amateur censoredcreampieamateurnnsnns-013nns013533nns-013
    • 2021-11-11
    157 min

    [SW-810]Huh!？ Even After Cumming, He"s Not Experiencing That Post-Coital Cumdown! So Instead, He"s Going To Keep On Creampie Fucking! On To Round 2! 3 Rounds Is A Given! These 3 Horny Sisters Secretly Slipped Me Some Super Hyper Aphrodisiacs!

  • censoredcreampieSWswitchraito fuji makotoswitch hibinoSW-810SW8101sw00810
    • 2021-11-12
    67 min

    FC2PPV 2426564 [Individual Shooting 61] 21-Year-Old Neat And Clean Half-Type Streak Pie Bread ③ Cleaning Fellatio From Continuous Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-12-11
    76 min

    [121121-001]Handjob service instead of unpaid salary

  • ayumu kurasawa uncensoredcreampiehandjobcaribbeancom
    • 2021-12-12
    72 min

    300MAAN-727 <Chastity Idea Gabagaba Young Wife! Abstinence Is Already The Limit In 2 Days! ？？ Complete Runaway Sex That Will Do Everything From Exposed Masturbation To Reverse Nanfera And Raw Vaginal Cum Shot! > The President’s Daughter Who

  • amateur censoredcreampiemarried womanmaanmaan-727maan727300maan-727
    • 2021-12-21
    45 min

    [HEYZO-2681]Miki Hoshino Female Teacher"s Immorality -Pantyless Slutty Seduces Her Student-

  • miki hoshino uncensoredcreampieheyzo
    • 2021-12-23
    51 min

    C0930 ki211223 Yukie Nakahashi 23years old

  • amateur uncensoredc0930
    • 2021-12-24
    121 min

    [HMN-095]What Secrets Does This Popular Sports Caster Hide Behind Her Cheerful Smile？ After A Lovey-Dovey Date, She"ll Tease Your Cock With Blatant, Gentle Dirty Talk Until Your Boy Goes Insane, And Then She"ll Pick Your Bones Dry With Consec

  • takehiro tomiyasu censoredanalcreampieHMNhon nakamiyoshi rusherHMN-095HMN095hmn00095
    • 2021-12-28
    99 min

    [NUBI-058](Acts Of Shame In The Bookstore) A College Girl Is Shamed In The Bookstore His Rock Hard Cock Entered Her Dripping Wet Cunt, And She Started Massively Squirting

  • censoredsquirtingblowjobNUBIkarimantannubiaNUBI-058NUBI058h-1112nubi00058
    • 2022-01-07
    140 min

    [SSIS-289]She Fucked Her Husband"s Dad To Get Back At Him Over An Argument, But What Was Suppose To Be A One-Time Fling Became A Long-Term Obsession... Minami Kojima

  • minami kojima censoredmarried womandramaSSISs one number one styleinabars1 no 1 styleSSIS-289SSIS289ssis00289
    • 2022-01-14
    66 min

    SIRO-4643 [First Shot] [Erotic Face X Erotic Voice] [Indecent Tongue] An H Cook Who Gets Drunk With The Sweet Stimulus After A Long Absence While Saying That It Is For The Cost Of Going On A Trip. She Shakes A Well-Shaped F Milk Every Time She Is Vio

  • amateur censoredbig titsamateursirosiro-4643siro4643siro-4643



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored