freshly picked




FC2ABWFSDSSDTTWAAAAUKSAVSAAMBIIPXHNDROYDMEYDAWDNACRPREDMIDESQTEHDKAHZGDMILKHMN

2020-12-05
149 min

[SHKD-920]College Girl Fucked After A Night Cap At Home - Suzu Monami

  • monami bell censoredsingle workSHKDattackerssharkSHKD-920SHKD920shkd00920
    • 2020-12-12
    118 min

    [MIAA-360]Over The Course Of 10 Long Years, My Big Stepsister Slowly Developed A Sensually Sensitive Pussy, And I Was Peeping The Entire Time As I Watched My Stepfather Use His Big Cock To Train Her Mitsuha Higuchi

  • mitsuha higuchi censoredcreampieblowjobMIAAmoodyztiger kosakaieveryone s porn starMIAA-360MIAA360miaa00360
    • 2020-12-16
    64 min

    FC2PPV 1608747 [First shot] I have had a dense and intense piss etch with a slender beauty full of exoticism ❤️❤️

  • amateur uncensoredfc2
    • 2020-12-18
    34 min

    [BTH-099]Raw Group Sex Girl - Kana Morisawa

  • kana morisawa kanako iioka censoredcreampieblowjobBTHchobitchchovicBTH-099BTH099h-1435bth00099
    • 2020-12-24
    84 min

    [sdgn-010]ちはるちゃん(21)

  • amateur censoredcreampiebig titssdgnsdgn-010sdgn010sdgn-010
    • 2021-01-09
    120 min

    [MEYD-644]My Friend's Mother - Ravished By Her Son's Friend, Made To Cum Over And Over... Shuri Yamaguchi

  • yuri yamaguchi censoredcreampiebig titsMEYDtameike gorohirokoji osakiMEYD-644MEYD644meyd00644
    • 2021-01-22
    72 min

    FC2PPV 1654786 [Major company model] Leaked ● Hard raw acme SEX at a secret cosplay photo session. A narrow pussy is opened with a thick cock and acme died in a few minutes. Forced seeding as it is (leaked Gonzo data)

  • amateur uncensoredfc2
    • 2021-01-23
    240 min

    [REXD-349]Girls Holding It In - Tied Up On The Station Toilet... "I Can't Hold It Any Longer... I'm Going To Wet Myself..."

  • censoredcreampieamateurREXDredmanji groupREXD-349REXD349rexd00349
    • 2021-02-03
    134 min

    [OVG-163]Suddenly Entering A Housewife's Home In The Morning While Her Husband Is Away And Giving Her A Raw Creampie Fuck!

  • kaori iiyama yuka hoshi censoredcreampiebig titsOVGglory questOVG-163OVG16313ovg00163
    • 2021-02-13
    73 min

    383REIW-045 Aoki-san

  • amateur censoredcreampiebig titsreiwreiw-045reiw045383reiw-045
    • 2021-02-25
    46 min

    [orec-699]すずね

  • amateur censoredcreampieamateurorecorec-699orec699orec-699
    • 2021-02-27
    33 min

    FC2PPV 1704769 A masterpiece K cup daughter Gonzo edition! After all the K cup was amazing w Wrapped in fluffy huge breasts and vaginal cum shot while dreaming ♥ * High quality version & review benefits included ♪ [Personal shooting / original]

  • amateur uncensoredfc2
    • 2021-02-28
    145 min

    [KTKC-108]Miyu-pon Is A Karate Master Tuber Who Likes To Toy With Men's Hearts, Because She's A "Cunning And Erotic Bitch" She's A Black Belt, But Usually She's A Maso And Obedient Sex Pet And Now This Video Is Being Released

  • censoredbig titsamateurKTKCkitixx mousouzokubig titsKTKC-108KTKC108ktkc00108
    • 2021-03-01
    123 min

    [NACR-399]The Hot Wife Next Door What Happened When She Entered The Wrong House Risa Mochizuki

  • risa mochizuki censoredcreampieslutNACRplanet plusdirector onanakuruNACR-399NACR399h-237nacr00399
    • 2021-03-06
    150 min

    [SHKD-937]She Didn't Know It Was An Escort Service - Naive Busty College Girl Applies To Work At A Massage Parlor And Ends Up Servicing Her Clients Eimi Fukada

  • emi fukada censoredcosplaybeautiful girlSHKDattackerssharkSHKD-937SHKD937shkd00937
    • 2021-03-12
    27 min

    359TYVM-137 Kaho

  • amateur censoredcreampieamateurtyvmtyvm-137tyvm137tyvm-137
    • 2021-03-13
    119 min

    [EBOD-812]More Than Masturbation But Less Than Lovers Sexfriend With Beautiful Tits And A Tight Pussy Lets Me Fuck Her When We Meet - Rui

  • censoredcreampiebig titsEBODe bodymichiru arashiyamaEBOD-812EBOD812ebod00812
    • 2021-03-26
    104 min

    [YSN-543]The Smell Of A Precocious Wife - Kanae Kawahara

  • kanae kawahara censoredcreampiesingle workYSNnonYSN-543YSN543h-127ysn00543
    • 2021-04-08
    64 min

    230OREC-730 Mizuki

  • amateur censoredcreampiebig titsorecorec-730orec730230orec-730
    • 2021-04-15
    245 min

    [BIJC-017]Hot Witch COLLECTION vol. 16

  • honoka takikawa manami oura censoredcreampiebig titsBIJCbeautiful witch emanuelbeautiful witchBIJC-017BIJC017bijc00017
    • 2021-04-20
    55 min

    H0930 ki210420 Youko Higashi 22years old

  • amateur uncensoredh0930
    • 2021-05-08
    245 min

    [KDMI-035]High Leg Fantasy Amazing

  • kimishima mio yano tsubasa censoredKDMImiludopamixKDMI-035KDMI035kdmi00035
    • 2021-05-18
    30 min

    FC2PPV 1823399 Limited time offer [Individual shooting] Prefectural general course ③ Staying with a stranger uncle who wants to sleep with money. Girl who is vaginal cum shot without permission

  • amateur uncensoredfc2
    • 2021-06-08
    142 min

    1Pondo 060821_001 Chisato Takayama : Chisato Takayama Special Edition

  • amateur uncensored1pondo
    • 2021-06-15
    128 min

    [KTRA-303]Creampie For My Step-Niece With An Adorable Voice Tsumugi Narita

  • narita tsumugi censoredcreampieuniformKTRAk tribeKTRA-303KTRA303
    • 2021-06-15
    177 min

    496SKIV-007 Atsuko-chan (22)

  • amateur censoredamateurskivskiv-007skiv007496skiv-007
    • 2021-07-31
    61 min

    Caribbeancom 073121-001 The Girl Who Is Always Releasing Pheromones Anri Tachibana

  • anri tachibana uncensoredcreampiehandjobcaribbeancom
    • 2021-08-01
    247 min

    [ZMAR-046]All! Airi Natsume

  • natsume atago censoredcreampiesquirtingZMARplanet plusmaruttoZMAR-046ZMAR046h-237zmar00046
    • 2021-08-06
    155 min

    [JUFE-317]My Wife Went To Visit Her Hometown For 7 Days, Leaving Me All Alone With My Stepdaughter - Who Sure Is Growing! A Record Of How She Whipped Out Her Colossal Tits, Sweat-Slicked And Bouncing While We Banged Until She Told Me She Loved Me Ren

  • reina taoyuan censoredcreampiebig titsJUFEfitchJUFE-317JUFE317jufe00317
    • 2021-08-07
    160 min

    [MDBK-192]A Beautiful Big Tits Massage Squeezes Out Your Cum Infinitely. Endless Pussy Treatment VIP Massage Parlor

  • hamazaki mao miina wakatsuki censoredcreampiebig titsMDBKk m producerakudabazookaMDBK-192MDBK192mdbk00192
    • 2021-09-04
    126 min

    [AVSA-179]Master"s Dirty Obedient Pet Bukkaked And Sweaty Miho Tono

  • miho tsuno censoredsingle workbukkakeAVSAavsjinguuji hikariavscollectorsAVSA-179AVSA179avsa00179
    • 2021-09-11
    148 min

    [SABA-721]Sharing A Hotel Room With My Coworker After We Went Out And Missed The Last Train... She Seemed So Unguarded, I Couldn"t Resist Her... vol. 012

  • censoredcreampieuniformSABAs kyuu shiroutotodoSABA-721SABA721saba00721
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-15
    132 min

    [GVH-288]Naughty Nurses - Honoka Tsujii

  • tsujii honoka censoredcreampiegrandfatherGVHglory questtakahashi chitsujiGVH-288GVH288gvh00288
    • 2021-09-17
    119 min

    [MEYD-705]NTR At My Part-Time Job I Was Listening To A Horny Married Woman Complain About Her Life, And Then She Started Having Creampie Sex With Me, Every Single Day Ichika Seta

  • kazuhana seta censoredcreampiebig titsMEYDtameike goroinugami ryouMEYD-705MEYD705meyd00705
    • 2021-09-17
    124 min

    [FOCS-024]Revealing The Actual State Of A Certain University! A Mixed Bathing Party In Open-air Bath! Super Erotic Camp Where They Party Hard! Natsuna Sasaki

  • natsuna sasaki censoredblowjobsingle workFOCSabc mousou zokufocusFOCS-024FOCS024focs00024
    • 2021-09-24
    117 min

    [DASD-920]Anal Sex With A Father-In-Law Whom I Hate To Death...The Foreign Wife Who Gets It Up Her Asshole. June Lovejoy

  • june lovejoy censoredanalcreampieDASDdassabasuhori nakaDASD-920DASD920dasd00920
    • 2021-10-01
    34 min

    FC2PPV 2281430 [No] [Limited To 100 Pieces 2980 → Off To 1480pt!] Excited To Be Seen By People! Metamorphosis Beauty ♥ ️ Even Though I Have A First-Class Secretary Test … Lol, ♥ ️ Massive Vaginal Cum Shot! !! ♥ ️ * Review Benefits / High Image Q

  • amateur uncensoredfc2
    • 2021-10-22
    135 min

    [SSIS-224]Mixed Body Fluids, Deep Sex: Totally Uncut Special Edition Fua Kaede

  • kaede fua censoredblowjobsingle workSSISs1 no 1 stylemonSSIS-224SSIS224ssis00224
    • 2021-10-22
    123 min

    [HMN-061]34 Years Old, Mother Of Two. Recruited For Serious Sex. Amazingly Naive Wife That Didn"t Even Know What A Dating App Was Is Super Horny For Her Creampie AV Debut! Satsuki Shiki

  • satsuki shiiki censoredcreampiesingle workHMNhonnakarassha miyoshiHMN-061HMN061hmn00061
    • 2021-11-16
    138 min

    [TEN-038]Yukemuri NAWA-KOKOKU 1 Rei Kurugi

  • satoshi kuruki censoredbdsmsingle workTENvan associatestenma harutenmaTEN-038TEN038h-859ten00038
    • 2021-11-19
    173 min

    [ROYD-074]My Gentle and Cute C***dhood Friend Spoils Me By S******g With Depressed Me. Karen Asahina

  • karen asahina censoredbeautiful girlsingle workROYDroyalmorikihhh groupROYD-074ROYD074royd00074
    • 2021-11-28
    65 min

    200GANA-2600 In The Spear Room Of The Nampa Master Of Hyakusen Renma, Bring In Sex Hidden Camera 227 Bring The Beautiful Legs Girls Who Made Friends At The Bar To The House! Play Sex Is Real Because They Are Aiming For One-Chan Each Other! To The Cli

  • amateur censoredamateurganagana-2600gana2600200gana-2600
    • 2021-12-10
    146 min

    [SSIS-257]Is She Luring Me To Temptation With Her Titties, Right Here!？ If We Get Caught, It"s Over, But Even Though We Can"t Make A Sound, My Girlfriend"s Older Sister Slut Keeps On Tempting Me With Her Big Tits And Rubbing Me With Immor

  • saki okuda censoredbig titsblowjobSSISs1 no 1 stylerokusaburo mishimaSSIS-257SSIS257ssis00257
    • 2021-12-10
    92 min

    ZOCT-042 Mikako (Mikako Horiuchi)

  • amateur censoredcreampieamateurzoctzoct-042zoct042zoct-042
    • 2021-12-24
    195 min

    [HUNBL-074]Wonder How Far I Can Go... Women Who Challenge The Limits Of The Back Of Their Throats

  • censoredcreampiebeautiful girlHUNBLhuntergeminihhh groupHUNBL-074HUNBL074hunbl00074
    • 2021-12-25
    43 min

    H4610 gol208 Mayu Satsukawa 21years old

  • amateur uncensoredh4610
    • 2022-01-01
    83 min

    534IND-019 First Shot J ● _p Live Video Leaked

  • amateur censoredcreampieamateurindind-019ind019534ind-019
    • 2022-01-06
    62 min

    520SSK-045 Riria

  • amateur censoredamateurbeautiful girlsskssk-045ssk045520ssk-045
    • 2022-01-17
    67 min

    328HMDN-445 [Slender Meat Bullet God Butt] Cute Wife 26 Years Old Working At A Flower Shop First Time Cheating And Sickness Hairy Pussy Squirting Continuous Vaginal Cum Shot (Ai Mukai)

  • amateur censoredcreampiemarried womanhmdnhmdn-445hmdn445328hmdn-445
    • 2022-01-28
    117 min

    [WAAA-141]"What？ Didn"t I Just Cum In You？" A Woman"s Premature Ejaculation Is Disguised By The Extended Pistoning Of The Cock. Misuzu Mifune

  • mifune misuzu censoredcreampiebig titsWAAAwanz factorywanzWAAA-141WAAA141waaa00141
    • 2022-02-10
    310 min

    [SUN-046]D***king Cum After Abstinence Since This Is The Last Time, Let"s Forbid Ourselves From Masturbating ... I Could Only Meet My Fuck Buddy Once A Month, And I Want Her To D***k My Cum Until My Balls Run Dry

  • censoredblowjobSUNsuntanaka baconSUN-046SUN0461sun00046
    • 2022-02-11
    160 min

    [PRED-375]Getting Creampie Loads Over And Over Again On A Business Trip, This Vigorous Boss Has A Dick That"s In Complete Control Of Me (New Female Employee Fresh Out Of College). Karen Yuzuriha

  • karen kaede censoredcreampiebig titsPREDpremiumbungo maedaelegancePRED-375PRED375pred00375
    • 2022-02-19
    240 min

    [OKAX-817]A Prim And Proper Mature Woman Unexpectedly Found Herself Performing Masturbation When We Laid A Trap For Her During Some Candid Peeping Camera Action 4 Hours

  • censoredamateurmature womanOKAXk m producedick mandokuokazuOKAX-817OKAX817okax00817
    • 2022-02-26
    74 min

    200GANA-2657 Seriously Nampa, First Shot. Picking Up An Older Sister In A Bread Class Who Is Chome-Chome With An Adult Friend With The 1763 App! She Is Also Interested In Toys, And She Rolls Up With A Rotor And Electric Massage Machine! Punch Line ●

  • amateur censoredbig titsamateurganagana-2657gana2657200gana-2657
    • 2022-03-18
    150 min

    [HMN-142]Completely Uncut Footage With Raw Cock Waking Her Up For A First Time Cumshot. Hard Creampie Sex Mixes Cum, Love Juices, And Raw Body Fluids. Mei Uesaka.

  • mei uesaka censoredcreampiesquirtingHMNbookcrestHMN-142HMN142hmn00142



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored