g 639




FC2SPRDMIDVSSNISANGMEMBLKABWSHKDVENXAMBIAUKSAVSAMILKSSISSTARSSQTEFSDSSNACXHUNTBAUKG

2020-11-28
118 min

[MIDE-850]Soft And Fluffy Smooth Skin G-Cup Beautiful Big Tits Nonstop Fuck Massage Parlor Girl's Cumming By Titty Fucking Full Course Shoko Takahashi

  • shoko takahashi censoredbig titsslutMIDEmoodyzdragon nishikawamoodyz divaMIDE-850MIDE850mide00850
    • 2020-12-01
    57 min

    C0930 ki201201 Yiu Higashiyama 33years old

  • amateur uncensoredc0930
    • 2020-12-07
    40 min

    [ore-728]マイナ

  • amateur censoredcreampieamateuroreore-728ore728ore-728
    • 2020-12-10
    121 min

    [FSDSS-136]My Girlfriend's Little Sister Is An Excessively Sensual Premature Ejaculator Who Will Lure You To Time-Saving Temptation In High-Class Lingerie Sora Shiina

  • shiina sky censoredbeautiful girllingerieFSDSSfalenogoemonfaleno starFSDSS-136FSDSS1361fsdss00136
    • 2020-12-23
    73 min

    SWEET-048 Nonora

  • amateur censoredbig titsschoolgirlsweetsweet-048sweet048sweet-048
    • 2020-12-27
    136 min

    [NKD-268]Eating Little Men - Mio Ichijo

  • ichijo mio censoredsingle workNKDnakajima kogyokanamoriNKD-268NKD268nkd00268
    • 2021-01-05
    239 min

    [SCR-261]Leaked Footage Posting: Slutty Stepsister Ambushes Her Sick Stepbrother In Bed 4 Hours

  • censoredcreampieslutSCRglay zs crimeSCR-261SCR26112scr00261
    • 2021-01-06
    55 min

    468NRPK-011 Tsukino

  • amateur censoredbig titsamateurnrpknrpk-011nrpk011468nrpk-011
    • 2021-01-17
    127 min

    [MRSS-104]I Looked Through My Wife's Phone And Found A Whole Collection Of POV Sex Tapes From The Time She Was A S*****t Made With Her Homeroom Teacher Yui Hatano

  • yui hatano censoredcreampiesingle workMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-104MRSS104mrss00104
    • 2021-01-17
    240 min

    [KTKY-054]She's The S*****t Council President... And A Cock-Loving Slut! The Best Combination Ever! 4 Hours

  • censoredbig titsschoolgirlKTKYkitixx mousouzokuKTKY-054KTKY054ktky00054
    • 2021-01-25
    67 min

    SIRO-4362 [First shot] [Female college student who likes vagina back] [Daddy service] 19-year-old simple female college student. An innocent girl climaxes many times with tears in the pleasure of her favorite vagina back .. Application amateur, first

  • amateur censoredamateursirosiro-4362siro4362siro-4362
    • 2021-01-29
    50 min

    [per-360]ひまり

  • amateur censoredamateurblowjobperper-360per360per-360
    • 2021-02-03
    124 min

    496SKIV-003 Mana who loves raw squirrel

  • amateur censoredamateurskivskiv-003skiv003496skiv-003
    • 2021-02-06
    230 min

    [BBAN-313]Girls Only! Picking Up Amateurs! Would You Like To Have Aoi Kururugi Make You Feel Good？ Enthusiastic Lesbian SEX!

  • aoi kururugi censoredsquirtinglesbianBBANvivianBBAN-313BBAN313bban00313
    • 2021-02-10
    53 min

    [ykmc-049]七海(19)

  • amateur censoredcreampiebig titsykmcykmc-049ykmc049ykmc-049
    • 2021-02-11
    121 min

    [GS-375]A Dripping Wet Girl With No Bra And Tiny Tits And Super Erect Nipples She Got Caught In A Sudden Rainstorm During Her Club Activities, And Now Her Tiny Titties And Button-Hard Nipples Were Soaking Wet, Because She Wasn't Wearing A Bra, So

  • censoredblowjobmature womanGSsosoru x garconspada ikebukuroGS-375GS375h-101gs00375
    • 2021-02-21
    198 min

    [MISM-195]The Craziest Deep Throating Secretaries: Deep Throat Service Special - Ayaka Mochizuki, Kanade Tsuchiya

  • ayaka mochizuki kana tsuchiya censoreddeepthroatMISMm girls labkokoa kuroMISM-195MISM195mism00195
    • 2021-03-05
    22 min

    10musume 030521_01 Secret Pussy Collection: Akane Maruyama

  • amateur uncensored10musume
    • 2021-03-08
    44 min

    302GERK-354 Ichika

  • amateur censoredcreampieamateurgerkgerk-354gerk354302gerk-354
    • 2021-03-13
    168 min

    [MIAA-404]See This Face Pussy Babe's Mouth Bulge When It's Full Of Cock The Anaconda Tongued Woman This Lady Boss Is Breaking In Her Deep Throat With Dick Sucking Glee Yumi Saeki

  • yuka saeki censoredblowjobdeepthroatMIAAmoodyzkogoro kindaichieveryone s porn starMIAA-404MIAA404miaa00404
    • 2021-03-17
    240 min

    [YVG-028]Tears, Squirting, Sweat, Saliva, Love Juices, And Female Body Fluids

  • censoredsquirtingYVGglory questYVG-028YVG02813yvg00028
    • 2021-03-18
    220 min

    [HUNTA-971]"Please Untie Me ... This Is So Embarrassing" I Tied Up My C***dhood Friend In Special Knots That Are Impossible To Untie By Herself, And I Put Her In The Paradise Lock Position, And When I Saw Her Thrusting Her Super Erotic Ass Ou

  • censoredschoolgirlHUNTAhuntergorilla butahhh groupHUNTA-971HUNTA971hunta00971
    • 2021-03-21
    31 min

    494SIKA-065 Vibe Fixed Irama + Demon Thrust Piston to Enko J ○

  • amateur censoredsquirtinguniformsikasika-065sika065494sika-065
    • 2021-03-22
    58 min

    FC2PPV 1736234 Active teenager. She is a girl who runs out of money on Twitter. She was cheeky, so DM exchange was released.

  • amateur uncensoredfc2
    • 2021-03-22
    102 min

    [NSPS-978]The Boss And His Wife Underling 14 - My Boss Took Advantage Of My Wife's Body - Saryu Usui

  • sakisui censoredmature womansingle workNSPSnagae stylenagaeNSPS-978NSPS978nsps00978
    • 2021-04-06
    481 min

    [MUCH-126]Plumped Up Labia - Chubby Shaved Pussy Girls 10 Continuous Fucks 8 Hours, 2 Discs

  • misaki hinata fumaru tomaru censoredbig titsMUCHmothermuchi mutchiMUCH-126MUCH126h-796much00126
    • 2021-04-06
    220 min

    [STARS-357]18 Year Old Amateur Sexy Model Himari Asada All Exciting New Experiences Fucks 4 Times

  • himari asada censoredbig titsbeautiful girlSTARSsod createeasy matsumotosod starSTARS-357STARS3571stars00357
    • 2021-04-09
    131 min

    [IPX-637]Ravished By The Grossest Boss - Pounded By His Huge Cock Until She Cums - Marked By His Seed Rio Kuriyama

  • rio kuriyama censoredsingle workdramaIPXidea pocketamazing meatdishIPX-637IPX637ipx00637
    • 2021-05-07
    243 min

    [NHDTB-524]Girls Okay With Being Groped Special Getting The Thin Beautiful Y********l With A Huge Ass That I Met At The Library To Let Me Feel Her Up Every Day And Cum All Over Her

  • censoredsquirtingschoolgirlNHDTBnatural highitaka smith rimpounderNHDTB-524NHDTB5241nhdtb00524
    • 2021-05-07
    240 min

    [MIDE-922]Celebrating Her 1-Year Anniversary In The Industry With The Ultimate French Kisses - 4 Fully Grown Fucks Rikka Ono

  • rokka ono censoredbeautiful girlslutMIDEmoody susapyonmoodyz divaMIDE-922MIDE922mide00922
    • 2021-05-15
    114 min

    [VEC-475]A Secret Between Me And My Friend's Mother. I Had Creampie Sex With This Older Woman... Nanao Nakano

  • nanao nakano censoredcreampiebig titsVECvenussarumegami venusVEC-475VEC475vec00475
    • 2021-05-15
    61 min

    FC2PPV 1810518 [On the verge of techno break] Newly-married neat wife, 25 years old. Clitoris hyperemia Massive tide splash On the verge of dehydration, seeding a newlywed pussy with a demon dick [broken]

  • amateur uncensoredfc2
    • 2021-05-22
    63 min

    Caribbeancom 052221-001 The soul sucking woman wearing a sweater Akari Satsuki

  • akari satsuki uncensoredcreampiecaribbeancom
    • 2021-05-22
    139 min

    [DBER-113]Female Body Rough Sex Institute III: JUDAS FINAL STAGE Story-5 - A Sexual Servant Climaxes When Faced With Crimson Fire Mako Oda

  • oda mako censoredmature womanbdsmDBERbabyentertainmentkikubonred babeDBER-113DBER113dber00113
    • 2021-06-10
    124 min

    [FSDSS-233]Devilish Y********l Who Loves Older Men Controls Their Ejaculations At Her Whim No Matter How Many Times She's Already Made Them Cum Hiyori Yoshioka

  • hiyori yoshioka censoredbeautiful girlhandjobFSDSSfalenopenisonicfaleno starFSDSS-233FSDSS2331fsdss00233
    • 2021-06-11
    67 min

    518ASGM-006 [Sleep Fucking / Intravaginal Ejaculation] School Trip Boyish Beautiful Girl Hidden Camera (Shizuoka / Prefectural / Ordinary Department) Estimated A Cup

  • amateur censoredcreampieamateurasgmasgm-006asgm006518asgm-006
    • 2021-07-02
    36 min

    520SSK-011 Rin

  • amateur censoredcreampieamateursskssk-011ssk011520ssk-011
    • 2021-07-02
    111 min

    [ADN-325]Fucked In Front Of Her Husband - Their Reunion Was Her Downfall II Ai Mukai

  • ai mukai censoredsingle workdramaADNattackerskazumaotona no dramaADN-325ADN325adn00325
    • 2021-07-17
    119 min

    [JUL-656]Exclusive: Minori Hatsune is Driven to Ecstasy before an Intense Vaginal Creampie!! Secretive Cheating Sex with a Hot Wife and Her Real Estate Agent.

  • hatsune minori censoredbig titsmature womanJULmadonnarokusaburo mishimaJUL-656JUL656jul00656
    • 2021-08-03
    58 min

    499NDH-026 [Urgent Coverage] Affair Creampie Sex In Exchange For Rewards! Married Woman Who Has Become Sexless With Her Husband Who Is Gambling Addiction [Translation Ali Debt Wife Case 2]

  • amateur censoredcreampiemarried womanndhndh-026ndh026499ndh-026
    • 2021-08-24
    68 min

    FC2PPV 2069574 * Limited To 3 Days 2980⇒1980 ★ First Shot ☆ Beautiful Legs Squeezed ♥ Black Hair Short ♥ Slender Beauty Satsuki-Chan 23 Years Old ☆ Obedient Rimming & Rich Blowjob ♥ Beauty Body Rebellion Intense Squirrel Cum Shot Sex ♥ * With Bene

  • amateur uncensoredfc2
    • 2021-08-30
    45 min

    358WITH-103 Haruna (21) S-Cute With Bath Chopsticks Gonzo H

  • amateur censoredamateurbeautiful girlwithwith-103with103358with-103
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-10-07
    119 min

    [AARM-023]She Rode Me Hard And Showered Me With French Kisses While Trapping My Cock In Between Her Thighs And Continuously Twisting And Tweaking My Dick Tip With Her 2 Fingers

  • natsuki shiori tsukada censoredhandjobAARMaroma kikakukadowaki shigeoaromaAARM-023AARM023aarm00023
    • 2021-10-23
    60 min

    FC2PPV 2366173 * 3980⇒1980 ★ First Shot ☆ Natural Bristles! Erotic Big Tits ♥ Whip Body Leica 20 Years Old ♥ I Love Vaginal Cum Shot ♥ Lustful Pussy ♥ Gachi Raw Squirrel Conceived Vaginal Cum Shot ♥ * With Benefits

  • amateur uncensoredfc2
    • 2021-11-11
    121 min

    [RCTD-430]Big Tits Female Professional Wrestler Rin Kan Hit A Dangerous Day Of Pain! A Series Of Fucking Creampie Deathmatch!

  • censoredcreampiebig titsRCTDrocketroot yamazakiRCTD-430RCTD4301rctd00430
    • 2021-11-14
    41 min

    248HDG-655 Applicant Wife Saddle Interview Anna

  • amateur censoredmarried womanamateurhdghdg-655hdg655248hdg-655
    • 2021-11-17
    36 min

    FC2PPV 2439990 Limited Number! !! [Uncensored] Female Students With Big Breasts Continue To Grow … Adolescent Girls ◯ Grab The Raw Fcup And Make Vaginal Cum Shot! !!

  • amateur uncensoredfc2
    • 2021-11-19
    120 min

    [SSIS-254]Coming a Terrific 109 Times! Convulsions, 3,900 Times! Squirting More Than 2,000 cc! Fua Kaede. An Eros company Awakening. A Special of Big Convulsions for the First Time.

  • kaede fua censoredsquirtingsingle workSSISs1 no 1 stylehasami kukaSSIS-254SSIS254ssis00254
    • 2021-11-20
    151 min

    [DGCEMD-088]This Is A Special Edition! With Special Video Creampie! Maid 2: Mei Satsuki - My Orders Are Absolute! The Body Of "Mei Satsuki" Can Be Completely Controlled!

  • satsuki mei censoredmature womanhandjobDGCEMDcelebrity friendsDGCEMD-088DGCEMD088dgcemd00088
    • 2021-12-14
    49 min

    230OREC-965 Miina-Sensei (Miina Konno)

  • amateur censoredcreampiebig titsorecorec-965orec965230orec-965
    • 2021-12-17
    82 min

    529STCV-046 A Cute And Erotic Reader Model Is Here! !! Seduce A Man With A Tightly Open Chest ♪ Small Devil Body Touch With A Sense Of Distance 0 & Squeeze With A Soggy Blowjob ♪ At The End, I Will Squeeze It Until It Becomes Empty With A Horny Wo

  • amateur censoredcreampieamateurstcvstcv-046stcv046529stcv-046
    • 2021-12-19
    56 min

    413INST-193 [Tsui * Jas Delivery Female College Student] Healing Angel (21 Years Old) Supporters 20,000 Class! Big Tits River Shooting Mane And Gonzo Cum Shot At The Hotel After Delivery (Hono Wakamiya)

  • amateur censoredcreampiebig titsinstinst-193inst193413inst-193
    • 2021-12-23
    68 min

    230OREC-968 Momo & Natsuki (Natsuki Kisaragi Minami Momo)

  • amateur censoredcreampiebig titsorecorec-968orec968230orec-968
    • 2021-12-28
    54 min

    498DDH-057 [Drink Karaoke With A Girl Friend! When I Approached With Drunken Momentum …] A Neat Girl Who Had Been Watching With Erotic Eyes For A Long Time, In Fact, Was Hungry For Ji ● Po! When I Show Off The Erected Thing, It Sucks With Glitte

  • amateur censoredcreampiesquirtingddhddh-057ddh057498ddh-057
    • 2022-01-08
    134 min

    [CMV-162]Tied Up And Wearing A Mouth Gag In A Densely Inhabited District. They Put A Vibrator In The Girl"s Panties And Left Her Alone.

  • miu susaki ayu kumano censoredbdsmCMVcinemagicmarukatsuvixenCMV-162CMV162cmv00162



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored