gal high vision censored schoolgirl creampie




FC2LULUHDKAMEYDPREDSSNIGVHSANNATRCHRVVENUSPRDSQTEDASDMIDVADNMIDECESDRBDCJODNACR

2020-10-22
120 min

[ARSO-20139]My Wife -Celeb Club- 139

  • rikako okamoto kawaguchi kanade censoredblowjobARSOaroundARSO-20139ARSO20139h-1378arso20139
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-10-28
    17 min

    10musume 102820_01 Secret Pussy Collection: Yuko Nomoto

  • amateur uncensored10musume
    • 2020-12-06
    105 min

    300MIUM-656 [Looks like this and cums convulsions] Rent a sports female college student with black hair and a pure heart as her! Completely REC the whole story that was spoiled up to the originally prohibited erotic acts by persuading! !! After enjoy

  • amateur censoredcreampiebig titsmiummium-656mium656300mium-656
    • 2020-12-21
    120 min

    [KSAT-027]A Personal Documentary! A Big Tits Wife Engages In Bodily Fluid-Secreting Aphrodisiac-Laced Mind-Blowing Sex Mayumi 30 Years Old

  • censoredcreampiebig titsKSATstrong woman s table daydream tribesix mantable of a strong womanKSAT-027KSAT027ksat00027
    • 2020-12-27
    80 min

    200GANA-2399 Seriously Nampa, first shot. 1575 Takeaway from a tavern with a little older sister in Shinjuku ♪ If you get drunk, duero-chan w Shaved pussy is soaked, and if you put it in, you will have a delicate body convulsions and it will get acme

  • amateur censoredamateurganagana-2399gana2399200gana-2399
    • 2020-12-31
    717 min

    [OFJE-291](First-Time Buyers Only) Limited Edition Original Dust Cover - First Fuck Of 2021 - 100 Gorgeous Porn Stars Packed Into The Ultimate New Years Gift Bag - All Sex, 12-Hour Special

  • yuma asami asuka kirara censoredbig titsblowjobOFJEs1 no 1 styleOFJE-291OFJE291ofje00291
    • 2021-01-01
    80 min

    [MBRAA-185]里見千春 恋のスキンシップ

  • satomi chiharu censoredsoloworkMBRAAspice visualMBRAA-185MBRAA185
    • 2021-01-03
    61 min

    10musume 010421_01 With My Friend: Play Red light, Green light With Adult Toy Yu Nagata Haruna Kawai

  • amateur uncensored10musume
    • 2021-01-24
    100 min

    [NSPS-962]Posted True Stories: My Wife Got G*******ged 13 - Tragedy At A Campsite - Hijiri Maihara

  • kiyoshi maihara censoredmature womansingle workNSPSnagae stylenagaeNSPS-962NSPS962nsps00962
    • 2021-02-01
    121 min

    [NACR-397]The Wife With Colossal Tits Next Door - She Mistook My Apartment For Hers! Mayu Suzuki

  • suzuki mayu censoredcreampiebig titsNACRplanet plusdirector onanakuruNACR-397NACR397h-237nacr00397
    • 2021-02-04
    88 min

    [REBD-531]Mahiro 2: I'm Home! Mahiro Tadai

  • mahiro yui censoredsingle workREBDrebeccachikara sawamuraREBD-531REBD531h-346rebd00531
    • 2021-02-06
    144 min

    [BBAN-311]Business Massage Parlor. Young Wife Seduced Into Lesbian Sex By Nimble Hands - Horny Married Slut Falls For Her Masseuse On A Business Trip. Hazuki Wakamiya Mao Kurata

  • wakamiya kurata mao censoredbig titslesbianBBANbibianBBAN-311BBAN311bban00311
    • 2021-02-07
    125 min

    [RPIN-047]She Only Wants To Be Fucked By Handsome Men! A Soft And Fluffy Bitch But She's Unable To Resist A Rock Hard Cock, And Started Drooling And Cumming...

  • censoredbig titsRPINlycopene mousouzokuRPIN-047RPIN047rpin00047
    • 2021-02-28
    123 min

    [MDUD-454]Wataru Ishibashi's Amateur Creampies 2

  • censoredcreampieamateurMDUDartwataru ishibashiartmodeMDUD-454MDUD454mdud00454
    • 2021-03-01
    119 min

    [SMSD-022]Female Prisoner Illusion - Aya Shiomi

  • aya shiomi censoredbdsmsingle workSMSDs m sniperSMSD-022SMSD022h-1126smsd00022
    • 2021-03-07
    32 min

    490FANY-31 Manami

  • amateur censoredamateurfanyfany-31fany31490fany-31
    • 2021-03-07
    53 min

    HEYZO 2474 Nonstop Sexual Orgasm – Akari Mizuki

  • akari mizuki uncensoredcreampiehandjobheyzo
    • 2021-03-15
    240 min

    [PYM-368]Self Shots Girls Film Themselves Getting Horny And Masturbating

  • censoredPYMprimoPYM-368PYM368h-283pym00368
    • 2021-03-21
    119 min

    [NNPJ-436](If You Don't Love Your Woman She'll Find Other Guys) Picking Up Unfaithful Wives Who've Broken Their Promises To Be Fuck Buddies! Getting Them Into Hotel Rooms To Cure Their Loneliness For Quick Fucks. These Married Sluts'

  • censoredcreampieNNPJnanpa japanNNPJ-436NNPJ436nnpj00436
    • 2021-03-29
    59 min

    511SDK-003 [Amateur Life Saddle] Fair Skin & Beautiful Breasts! Ren-chan! Gonzo videos big tits

  • amateur censoredbig titsamateursdksdk-003sdk003511sdk-003
    • 2021-03-30
    129 min

    [STARS-355]"Stop It, Dad..." This Young Wife Can Never Tell Her Husband About The Way Her Twisted Father-In-Law Makes Her Drown In The Pleasure Of French Kisses And Guilty Fucks Yuna Ogura

  • yuna ogura censoredsingle workdramaSTARSsod createryo inugamisod starSTARS-355STARS3551stars00355
    • 2021-04-02
    118 min

    [JUL-525]Lace Queen Cuckholding Married Madonna With Beautiful Golden Legs! First Cuckholding Video Yuna Kitano

  • yuna kitano censoredbig titsmature womanJULmadonnarokusaburo mishimaJUL-525JUL525jul00525
    • 2021-04-03
    240 min

    [YLWN-162]I Came With Several Men, While My Husband Watched ... 4 Hours

  • censoredcreampiebig titsYLWNyellow moonpatpong tateishiYLWN-162YLWN162ylwn00162
    • 2021-04-08
    24 min

    HEYZO 2495 Marina’s Orgasms with Toys – Marina Hasumi

  • marina hasumi uncensoredheyzo
    • 2021-04-09
    180 min

    [IPX-647]Shocking News! Independent Porn Actress Tsumugi Akari Investigates The Brothels Everybody's Talking About: Night Clubs! Hostess Bars! BDSM Clubs! Erotic Massage Parlors! Swingers' Parties, And More - She Throws Her Whole Body Into He

  • akari tsumugi censoredbeautiful girlslutIPXidea pocketinjan kogadishIPX-647IPX647ipx00647
    • 2021-04-13
    58 min

    299EWDX-357 A transparent black strike and huge breasts invite a man. Libido contrary to the innocent face!

  • amateur censoredcreampiebig titsewdxewdx-357ewdx357299ewdx-357
    • 2021-04-15
    45 min

    FC2PPV 1770793 [Limited to 3 days, 40 off] [Soft milk banzai] Chinatsu ★ Big breasts married woman ♪ Amazing boobs over the meter! 100cm dripping soft milk I cup milk is rubbed until it is deformed w A man’s yogal face is my favorite ☆ But a slu

  • amateur uncensoredfc2
    • 2021-04-24

    H4610 ki210425 Rina Tachikawa 26years old

  • amateur uncensoredh4610
    • 2021-05-07
    68 min

    518ASGM-001 [Sleep Fuck / Intravaginal Ejaculation] Shortcut Bishoujo М (Saitama / Private / Ordinary Course / Tennis Club) Estimated C Cup

  • amateur censoredcreampieuniformasgmasgm-001asgm001518asgm-001
    • 2021-05-28
    116 min

    [EKW-070]Making Men Cum Over And Over With Seductive Dirty Talk! Slut Begs To Drain Men Of Their Cum Mao Kurata

  • kurata mao censoredcreampiebig titsEKWwaap entertainmentk westcobra warpEKW-070EKW0702ekw00070
    • 2021-06-01
    140 min

    [SDNM-281]This MILF Leaks Breast Milk When She Cums - Azumi Suzuhara, Age 27, Final Chapter - She's Ready For K*d Number Two With All The Creampie Sex She's Having - 17 Loads, 8 Cocks, Fucked Right At Home While Her Husband's Away, Breast

  • azumi suzuhara censoredsingle workSDNMsod createbacon tanakagenuine married woman the porn experienSDNM-281SDNM2811sdnm00281
    • 2021-06-01
    120 min

    [NACR-425]I Couldn't Control My Lust After Seeing My Widowed Step Mother In Sexy Tight Yoga Clothes Mai Kitagawa

  • mai kitagawa censoredbig titsblowjobNACRplanet plusbito sakurananakuruNACR-425NACR425h-237nacr00425
    • 2021-06-01
    160 min

    [DROP-062]Amateur Girls Their First Time Working Part-Time Washing Dicks 5

  • censoredcreampieamateurDROPoffice k sdrop office k sDROP-062DROP06236drop00062
    • 2021-06-12
    78 min

    200GANA-2501 Seriously Nampa, first shot. 1647 Show off magic to girls in Harajuku! Bring an interested girl to the hotel! Guide in the erotic direction with magic using condoms! The slender long legs and the crisp buttocks are exposed and disturbed!

  • amateur censoredamateurganagana-2501gana2501200gana-2501
    • 2021-06-15
    40 min

    [NYH-135]On A Crowded Bus, I Get Close To A Married Woman With Big Tits On Her Way Home From Shopping And Put My Hard Cock Up Her Miniskirt To Arouse Her And Fuck Her On The Spot / Miss Yuika Yuika Takashima

  • yuka takashima censoredbig titsmarried womanNYHdirectorsdirectorsnyan nyan houseNYH-135NYH1351nyh00135
    • 2021-06-25
    238 min

    [BMW-237]Only S*********ls! 90 Creampies While Fucking In Uniform!! Pile-Driving Cowgirl Best

  • satoshi kuruki tsubaki rika censoredcreampieuniformBMWwanz factorywanzBMW-237BMW237bmw00237
    • 2021-07-03
    55 min

    HEYZO 2558 Nipple Tortured By Beautiful Slut – Mio Futaba

  • mio futaba uncensoredcreampiehandjobheyzo
    • 2021-07-09
    150 min

    [MIAA-464]If You Want to Advance in School Take my Throat Fuck. Beautiful Y********l in Uniform Obedient Deep Throat Slut

  • maika hizumi censoreduniformdeepthroatMIAAmoodyzkogoro kindaichieveryone s porn starMIAA-464MIAA464miaa00464
    • 2021-07-11
    47 min

    FC2PPV 1917351 Up to 18 2000 [No] Fair-skinned busty beauty college student. Although she reluctantly resists, she is forcibly fucked by multiple men and vaginal cum shot is made continuously on her dangerous day.

  • amateur uncensoredfc2
    • 2021-07-14
    70 min

    428SUKE-079 [F Cup + Shaved Beauty And Creampie Trip] Borrow A Mobile Battery And Pacopaco Sp With Students Just Before Summer Vacation! !! It’s Amazing When You Take It Off! ？？ F Cup Boobs Explode! Watching Av Makes You Horny → Eliminates Libid

  • amateur censoredcreampiebig titssukesuke-079suke079428suke-079
    • 2021-07-16
    71 min

    [YMDS-044]An Uhar Bitch A Spanish Bitch With A Glamorous Body EMILY

  • emily hikari sakuraba censoredbig titsblowjobYMDSmomotaro video publishingdukeyoung peachYMDS-044YMDS044ymds00044
    • 2021-07-20
    99 min

    [SPZ-1108]Where Won't You Fuck？! Refreshing Swimsuit Girl In A Private Room

  • censoredSPZstar paradisestar paradiesSPZ-1108SPZ1108h-254spz01108
    • 2021-08-14
    129 min

    [ONSG-040]Booby Lady At Your Service Riku Serina

  • serina riku censoredcreampiebig titsONSGgeinko pore shongain corporationONSG-040ONSG040onsg00040
    • 2021-08-18
    134 min

    [GVH-275]Unyielding Female Boss With A Slutty Body, And Her Sexy Stepchild Yuri Honma

  • really censoredcreampiebig titsGVHglory questhyonGVH-275GVH27513gvh00275
    • 2021-08-21
    76 min

    FC2PPV 2056471 * Limited Time Price & Limited Bonus [Teacher License Deprivation] At The End Of School, Look For A Man With An App Dirty Talk Barrage Big Ass Cowgirl Dimension Stop Slut Play & Demon Egg Piston Conceived Gachi Acme Fuckin !! [Ad

  • amateur uncensoredfc2
    • 2021-08-21
    124 min

    [CPSN-005]A Wife"s Beautiful Body - Junko Kisaragi

  • junko kisaragi censoredcreampiebig titsCPSNtoyohikotoyohikotoyohiko kikakuCPSN-005CPSN005cpsn00005
    • 2021-08-25
    59 min

    489IKUIKU-007 Marie

  • amateur censoredcreampiebig titsikuikuikuiku-007ikuiku007489ikuiku-007
    • 2021-09-14
    129 min

    FC2PPV 2196009 Former Ha ● Professional Trainee [2013, 2015 Audition Group] * Early Purchase Recommended *

  • amateur uncensoredfc2
    • 2021-09-24
    149 min

    [HMN-043]Am I An Adult If You Cum Inside Me？ Girl With Short Bob Who Is Still New. First Creampie Kazuna Yuki

  • kazuna yuki censoredcreampiebig titsHMNhonnakausapyonHMN-043HMN043hmn00043
    • 2021-10-29
    124 min

    [MIAA-523]"Mom"s New Husband Has It Out For Me" Mom Is Away All Week, And Now My Terrible Step-father Gives Me His Dick To Fuck For Squirting Orgasms And Pleasure. Mitsuki Hirose

  • mitsuki hirose censoredcreampiesquirtingMIAAmoodyzdoragon nishikawaminna no kikatanMIAA-523MIAA523miaa00523
    • 2021-11-04
    61 min

    336KNB-179 [The Most Erotic Married Woman Of The Year] Spree While Cramping! De M Wife With Fair Skin! You Can See This Eroticism! !! At Kannai Station, Yokohama City, Kanagawa Prefecture

  • amateur censoredmarried womanamateurknbknb-179knb179336knb-179
    • 2021-11-13
    93 min

    300MAAN-716 [H-Cup Big Breasts JD Full Of Motherhood] Kotone-Chan, A Luxury Hostess Who Wants To Drink Together For A Long Time, Appears! Erotic Tech With Plenty Of Capacity Is Superb! !! The Boobs Are Too Big And The Boobs And Boobs Fill Up The Man

  • amateur censoredbig titssquirtingmaanmaan-716maan716300maan-716
    • 2021-11-19
    210 min

    [ROYD-073]Slut Friends Cum Together - Hard! Horny Nymphos Devour Your Cock... Minami Hatsukawa Yu Shinoda

  • hatsukawa minami shinoda yu censoredmomROYDroyalmorikihhh groupROYD-073ROYD073royd00073
    • 2021-11-26
    62 min

    [NAG-002]Picking Up Classy Wives For Semen D***king Aoyama Version: Serious Amateur Wife Over 30 Takes Her First Bite Rena, 33 Years Old

  • censoredmarried womanblowjobNAGcosmos videoNAG-002NAG0021nag00002
    • 2022-01-01
    130 min

    [GAS-492]God"s Descent Paisley Star Shiori Tsukada

  • shiori tsukada censoredbig titsslutGAScinema unit gasa tgasGAS-492GAS49271gas00492



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored