gvh




FC2EBODMILKJULLULUSDABAWDMARAABWADNHMNGMEMHNDDTTCAWDAVSAFSDSSIPXGVHBLKHDKA

2020-10-06
140 min

[KMHRS-027]I Want To Suck Plenty Of Cocks, So We'll Give Her 15 Dicks To Suck, And We Want All Of Them To Shower Her With Bukkake Semen Splatters! Laila Takizawa

  • lyra takizawa censoredamateursingle workKMHRSsod createtrendy yamaguchikimihoreKMHRS-027KMHRS0271kmhrs00027
    • 2020-10-06
    83 min

    [SDMF-016]It Was Summer In The Country, And I Was A Cherry Boy, And My Older Cousin Made A Joke, And I Took It Seriously, And Continuously Creampie Fucked Her The Peachy Clan Vol.18 Iori Kogawa

  • iori furukawa censoredcreampiesingle workSDMFsod createeasy matsumotopeach familySDMF-016SDMF0161sdmf00016
    • 2020-10-15
    58 min

    [orex-203]舞香 2

  • amateur censoredamateurorexorex-203orex203orex-203
    • 2020-10-18
    89 min

    AVHD-098 Kanna

  • amateur censoredamateuravhdavhd-098avhd098avhd-098
    • 2020-10-25
    145 min

    [AGAV-036]The Consecutive Ejaculation Training Camp - When This Slender Slut With Short Hair Spends The Night With An Adult Video Actor, How Many Times Will She Cum？ - Mana Hirade

  • hirate mana censoredcreampieblowjobAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-036AGAV036agav00036
    • 2020-11-01
    86 min

    [yrtb-008]ヒカル

  • amateur censoredcreampieamateuryrtbyrtb-008yrtb008yrtb-008
    • 2020-11-06
    47 min

    [gerk-318]カホ

  • amateur censoredamateurslutgerkgerk-318gerk318gerk-318
    • 2020-11-06
    43 min

    [gerk-325]あおいさん 3

  • amateur censoredcreampieamateurgerkgerk-325gerk325gerk-325
    • 2020-11-13
    107 min

    [MGMJ-046]Going To A Massage Parlor Specializing In Masochistic Men And Getting Fucked Silly With Their Special Treatment - Yuka Hirose

  • yuka hirose censoredanalslutMGMJmegamibeautiful goddess fetishMGMJ-046MGMJ046mgmj00046
    • 2020-11-22
    103 min

    428SUKE-049 [Red-haired gal player playing moistened] Pakopako SP at a hotel with a gal who invites you to charge your smartphone and plays the clarinet! !! Ejaculation is inevitable with big fucking! ？？ A vibe is sucked in Ma ● Ko, a lewd bare blowj

  • amateur censoredcreampiebig titssukesuke-049suke049428suke-049
    • 2020-12-07
    67 min

    SIRO-4348 [First shot] [Like teenage breasts] [Mistress’s unfaithfulness] Mistress’s sex appeal that captivates a man. A scream close to a scream while disturbing the huge breasts to the pleasure that penetrates to the back that could not b

  • amateur censoredbig titssquirtingsirosiro-4348siro4348siro-4348
    • 2020-12-10
    129 min

    [IENF-109]I'm Surrounded By Girls, And I'm The Only Guy!？ We're Playing Truth Or Dare!! Before I Realized It, My Little Stepsister's Classmate Had Stripped Me Naked... 2

  • somaka mahoro kamiki censoredcreampieschoolgirlIENFienergytiger kosakaiienfIENF-109IENF1091ienf00109
    • 2020-12-11
    195 min

    [BAZX-262]Working Girl Wants To Get Choked. vol. 001

  • censoredcreampieuniformBAZXbazookatodoBAZX-262BAZX262h-1496bazx00262
    • 2020-12-17
    110 min

    [ROYD-034]So Horny I Can't Stop At Just One Load! Nailing My Private Tutor Hard! Eru Sato

  • sato l censoredcreampiebeautiful girlROYDroyalaldebaranhhh groupROYD-034ROYD034royd00034
    • 2020-12-25
    50 min

    [MNSE-006](Online Only) S********l In Uniform - Taken, Bound, And Made To Fuck Shizuku

  • censoredcreampieuniformMNSEcrystal picturemaniac plusMNSE-006MNSE00649mnse00006
    • 2020-12-27
    115 min

    [JJBB-0001]We Heard About This Mature Woman Pink Salon Where The Ladies Were Loose And Easy, So We Decided To See How Far We Could Go 01

  • censoredcreampiemarried womanJJBBmature japanJJBB-0001JJBB0001jjbb000001
    • 2020-12-27
    159 min

    [AUKS-121]Shemale Lesbian -Kinky Slender Babe & Wild Clit-Dick Cutie- Kana Sayuki Kanna Uno

  • sanayuki kana uno sakina abe sakina censoredanallesbianAUKSu krentoAUKS-121AUKS121auks00121
    • 2020-12-27
    239 min

    [DBVB-034]These She-Males Are Weeping Like Mad While Receiving Hot, Spasmic Love Highlights A Cross-Dressing Orgasmic Tale Of Ecstasy We'll Show You, From Start To Finish, How They Cum, Over And Over Again, And Even With Anal Pleasure

  • akitsu komachi mayuri censoredDBVBbabyentertainmentvenus babyDBVB-034DBVB034dbvb00034
    • 2020-12-29
    57 min

    H4610 tk0027 Kaya Matsushita 20years old

  • amateur uncensoredh4610
    • 2021-01-12
    481 min

    [KTRA-269]Back-To-Back Fucks With Your Short-Haired, Beautiful Stepsister - 10 Girls, 8 Hours, 2 Discs

  • miki sanada mayu saito censoredcreampiebig titsKTRAk tribeKTRA-269KTRA269h-094ktra00269
    • 2021-01-13
    43 min

    230ORE-742 A sensei

  • amateur censoredcreampiebig titsoreore-742ore742ore-742
    • 2021-01-19
    62 min

    HEYZO 2443 Orgasms With A Horny Pussy Girl Vol.11 – Kana Takashima

  • kana takashima uncensoredcreampieheyzo
    • 2021-02-01
    121 min

    [HDKA-226]Naked Housewife - Riho Fujimori From Meguro, Tokyo (24)

  • riho fujimori censoredcreampiebig titsHDKAplanet plusdirector orafu shukoHDKA-226HDKA226h-237hdka00226
    • 2021-02-19
    74 min

    [OTIM-057](For Streaming Editions) (Daydream POV Fantasies) A Shameful Maid Who Will Fuck On Her Ovulation Day Tsumugi Narita

  • narita tsumugi censoredcreampieblowjobOTIMprestigeonetimeOTIM-057OTIM057118otim00057
    • 2021-02-20
    62 min

    [WKD-039]A Video Sex Record Of Adultery, Committed During A Married Woman Secret Meeting Reiko Kobayakawa

  • kobayakawa reiko censoredcreampiebig titsWKDwaap entertainmentk westwWKD-039WKD0392wkd00039
    • 2021-03-12
    86 min

    SNYZ-022 Rin-chan 2 (Maria Ousawa)

  • amateur censoredamateurcosplaysnyzsnyz-022snyz022snyz-022
    • 2021-03-26
    42 min

    330PER-377 Rika

  • amateur censoredbig titsuniformperper-377per377330per-377
    • 2021-04-10
    118 min

    [APNS-235]Slut In Debt Maron Natsuki

  • marin natsuki censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-235APNS235apns00235
    • 2021-04-14
    120 min

    [SSIS-050]The Boss Was Gone On A Business Trip, So I Fucked His J-Cup Wife For Three Days Straight. Rara Anzai

  • anzai rara censoredbig titssingle workSSISs1 no 1 stylegoemonSSIS-050SSIS050ssis00050
    • 2021-04-14
    108 min

    374IMGN-006 Karen

  • amateur censoredcreampieamateurimgnimgn-006imgn006374imgn-006
    • 2021-04-15
    60 min

    H4610 ki210415 Kanami Watanuki 26years old

  • amateur uncensoredh4610
    • 2021-04-17
    120 min

    [HND-974]Fresh Face: Dentist Working In Shibuya, Kindly Masked Angel, Willing To Wear Masks For A Creampie! Konoka Satsuki

  • may flower censoredcreampiebig titsHNDhon nakacontour styleHND-974HND974hnd00974
    • 2021-05-20
    300 min

    [SVDVD-858]H*********n: Male And Female S*****ts Alike Get Naked At This Nursing College To Learn Practical SK**ls 2021

  • hinako mori rumi tadami censoredcreampiesquirtingSVDVDsadistic villageista girl and her shameSVDVD-858SVDVD8581svdvd00858
    • 2021-06-19
    161 min

    [MISM-203]Heart Closed, Anal Hole Open. Beautiful Girl With Zero Sexual Experience Wants It In The Back Door

  • censoredbeautiful girldeepthroatMISMm girls labMISM-203MISM203mism00203
    • 2021-07-04
    61 min

    HEYZO 2559 Glasses-wearing Busty Girl In Business Shirt Got Fucked! – Satomi Kojima

  • satomi kojima uncensoredcreampiehandjobheyzo
    • 2021-07-26
    82 min

    484SDGN-015 Let’S Spread To The World! Nakadashi No Wa! I Urged An AV Actress And Made A Vaginal Cum Shot! Vol.3 ~ Mio Ichijo ~

  • amateur censoredcreampiesquirtingsdgnsdgn-015sdgn015484sdgn-015
    • 2021-07-30
    124 min

    [NKKD-220]夫婦念願の田舎暮らし…だがそこで農業従事者様のデカチンをめりめり挿れられてめろめろにされた妻 夕季ちとせ

  • chitose in the evening censoredsingle workNKKDjet eizougroupNKKD-220NKKD220nkkd00220
    • 2021-08-06
    185 min

    FC2PPV 1960983 [No Amateur Individual Shooting] 100th Work Arrival Commemorative Exposure Work! Large Release Of All The Cultivated Exposure! Perverted Superb Body Naked Wife’S Outdoor Continuous Naked Exposure! The Tag Comes Off And It Becomes

  • amateur uncensoredfc2
    • 2021-08-07
    160 min

    [MDBK-192]A Beautiful Big Tits Massage Squeezes Out Your Cum Infinitely. Endless Pussy Treatment VIP Massage Parlor

  • hamazaki mao miina wakatsuki censoredcreampiebig titsMDBKk m producerakudabazookaMDBK-192MDBK192mdbk00192
    • 2021-08-11
    96 min

    [ETQR-269][Daydream POV] Temptation Of, And Sex With, A Slut And Beautiful Girl, Marina Saitou

  • marina saito censoredcreampieuniformETQRerotic timeETQR-269ETQR269etqr00269
    • 2021-08-14
    61 min

    300NTK-623 [Big Breasts Kyaba Miss] [After Raw Sex] [Tokuno Customer Service 2 Squeezing] Big Breasts Kyaba Miss After Raw Sex With Sex! !! Dochashiko G Milk Pressure Customer Service Induces Erection Ji ○! !! Serious Positive Sexual Intercourse Of T

  • amateur censoredcreampiebig titsntkntk-623ntk623300ntk-623
    • 2021-08-20
    133 min

    [HZGD-195]My Ex-Girlfriend Got Married With My Best Friend, So I Stole Away Her Heart And Soul And Her Body With Kissing Creampie Pure Loving Sex Sakura Tsukino

  • tsukino sakura censoredcreampiesingle workHZGDhitodzuma hanazono gekijouzampaHZGD-195HZGD195h-1100hzgd00195
    • 2021-08-31
    25 min

    FC2PPV 2115039 [Distributing A Limited Number Of Review Benefits] When I Asked A Pregnant Married Woman If She Would Get Pregnant With The Sperm Of Another Person, She Said That It Was Not An Immediate Answer, So I Tried Forced Vaginal Cum Shot.

  • amateur uncensoredfc2
    • 2021-09-03
    180 min

    [MIDE-966]First Experience Documented! The Virgin Boy Came, But I Keep On Training Him, Hana Kotone

  • kotoneka censoredbeautiful girlslutMIDEmoodyzoosaki hirokoujimoodyz divaMIDE-966MIDE966mide00966
    • 2021-09-04
    140 min

    [KTB-050]Dressed Colossal Tits - The Sexual Councelor Hana"s ( I Cup) Confessions- Hana Himesaki

  • himesaki hana censoredbig titssingle workKTBkahanshin tigers mousozokukahanshin tigersKTB-050KTB050ktb00050
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-17
    120 min

    [EYAN-175]Chubby Lewd Beautiful Wife With Big Tits Wants To Get Pregnant Again With Nonstop Creampie Sex When Husband Is Away. 36 Hours For Risky Unprotected Sex. 22-Year-Old Kasumi.

  • censoredcreampiebig titsEYANe bodyakai suiseihanazakari no tsumatachiEYAN-175EYAN175eyan00175
    • 2021-09-24
    111 min

    [WZEN-049]Banned 02: Life Insurance Salesperson Keiko (26)

  • censoredcreampiesquirtingWZENwaap entertainmentnaomiWZEN-049WZEN0492wzen00049
    • 2021-10-08
    125 min

    [HUNBL-064]My Younger Stepsister Suddenly Started Putting On Weird Make Up, So I Fucked Her and Restored Her To Her Cute Self!

  • censoredcreampiesisterHUNBLhuntergeminihhh groupHUNBL-064HUNBL064hunbl00064
    • 2021-10-15
    118 min

    [PRED-347]Husband Is Away On A Business Trip... My Father-in-law Takes Me Quietly By The Hips For Non-stop Body Shaking Fucking. Yuki Takeuchi

  • yuki takeuchi censoredcreampiesingle workPREDpremiumkyaputen ebaraelegancePRED-347PRED347pred00347
    • 2021-10-21
    68 min

    OREX-307 Mahiro-Chan (Mahiro Ichiki)

  • amateur censoredcreampieschoolgirlorexorex-307orex307orex-307
    • 2021-10-22
    100 min

    [YST-258]I Don"t Care If It"s The Right Thing To Do Or Not, I Want To Fuck Hirai-san Like Mad - Kanna Hirai

  • shiori hirai censoredcreampiedeepthroatYSTkoyachoYST-258YST258540yst00258
    • 2021-10-22
    50 min

    FC2PPV 2364487 I Tried To Confine A Strong Erotic Man Who Has Only Two Erotic Pheromone Beauties And Ji ● Po In The Same Room

  • amateur uncensoredfc2
    • 2021-11-25
    139 min

    [FANH-035]Leaked Private POV Footage Of A Model! Two Videos Of Bombshell Model M*i Begging And Pleading For Cum, And Then Climaxing While Getting Creampied!

  • censoredcreampiebig titsFANHhamedori.network secondeditionFANH-035FANH035h-1472fanh00035
    • 2021-11-27
    67 min

    300NTK-665 [Neat And Clean Dobitch Girl] [Moe Jargon Attack Uniform Convulsions Nn2] [Hidden Jargon ● Boyne Discovered! !! ] People Do Not Look Like! !! Such A Neat And Orthodox Beautiful Girl Is A Nasty And Beautiful Busty Hidden Boyne-Chan …!

  • pinnn censoredcreampieuniformntkntk-665ntk665300ntk-665
    • 2021-12-02
    61 min

    Pacopacomama 120221_566 Seduced By Devilish Lips Kaori Buki

  • amateur uncensoredpacopacomama



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored