gym wear bloomers high vision schoolgirl ass fetish censored




FC2AVSABBANSHKDMVSDVENXEBODSSISCHRVDASDSQTECESDPPPDHDKAVEMAIPXCAWDCJODNGODRBDPRED

2020-09-26
125 min

[WANZ-989]My Busty Married Coworker Let Me Stay At Her Place When I Missed The Last Train Home... She Lounges Around Without A Bra And I Couldn't Resist The Way She Jiggled - We Wound Up Fucking All Night Long! JULIA

  • julia censoredcreampiebig titsWANZwanz factorywanzWANZ-989WANZ989wanz00989
    • 2020-09-29
    66 min

    [ZOZO-015]The New Female Teacher At An All Boys' School Has Her Body Turned Into A Practical Demonstration - Ms Maron Natsuki Edition

  • censoredbig titsZOZOsadistic villageZOZO-015ZOZO0151zozo00015
    • 2020-10-02
    242 min

    [MMB-328](Fucking Absolutely Not Allowed) This Beautiful Massage Parlor Therapist's Magical Touch Was So Pleasant, I Fucked Her, In The Raw

  • jinguji temple nao kimishima mio censoredcreampieMMBmomotarou video publishingdr ishikiribashimomotaro bestMMB-328MMB328mmb00328
    • 2020-10-17
    111 min

    390JAC-065 [H huge breasts metamorphosis full course x 3 vaginal cum shot] Shame exposure → bondage → intense SEX! Shake and shake, my heart is now ♪ I can’t believe anything ♪ It was Hcup that was in bloom ♪ Nostalgic songs also shook and shook

  • amateur censoredcreampiebig titsjacjac-065jac065390jac-065
    • 2020-10-22
    91 min

    [mgmr-128]NONONO(23)

  • amateur censoredbig titsamateurmgmrmgmr-128mgmr128mgmr-128
    • 2020-10-23
    133 min

    [DFE-047]She Loves To Fuck At The Office! Domme Boss Kisaragi Breaks In Her Male Subordinates - Playing Hookey For Bondage Sex Natsuki Kisaragi

  • natsuki kisaragi censoreddeepthroatbdsmDFEwaap entertainmentikkyu senfearlessDFE-047DFE0472dfe00047
    • 2020-10-31
    61 min

    [stfx-015]みさ

  • amateur censoredamateurblowjobstfxstfx-015stfx015stfx-015
    • 2020-11-01
    57 min

    324SRTD-0198 The celebrity office lady who applied was super erotic and was a master of blowjob w

  • amateur censoredamateursrtdsrtd-0198srtd0198324srtd-0198
    • 2020-11-12
    77 min

    FC2PPV 1566327 [Saku over home run semen] A large amount of bukkake was aimed at the face of a Saba Saba girl

  • amateur uncensoredfc2
    • 2020-11-18
    30 min

    [CSDX-001][VR] Cosplay & Kaho Shibuya

  • kaho shibuya censoredbig titssquirtingCSDXcrystal picturecosdeluxeCSDX-001CSDX00149csdx00001
    • 2020-11-19
    480 min

    [HHOY-005]"Cut It Out Already..." Girls Claim They Don't Like Getting Hit On At Work, But Their Pussies Are Getting Soaked In Spite Of Themselves - Secret Sluts Highlights Collection.

  • censoredHHOYdinner.companyhhh groupHHOY-005HHOY005hhoy00005
    • 2020-11-21
    59 min

    FC2PPV 1579053 ★ Appearance ☆ Honwaka Lori Lori daughter ♥ Active JD Usamin 21 years old ☆ Sensitive pussy electric massager ♥ It does not look good on the face and it is a footjob with intense erotic caress ♥ With benefits!

  • amateur uncensoredfc2
    • 2020-11-29
    82 min

    476MLA-018 [Explosive tide Iki underground idol] Even if love is prohibited, the nature is a lewd girl who likes blowjob ♪ M constitution that holds in the back of the throat! !! Slender beauty busty body cramps spectacular piston cum shot cum! !! !!

  • amateur censoredcreampiebig titsmlamla-018mla018476mla-018
    • 2020-12-06
    60 min

    [ZOZO-024]Healthy P.E. At A Coed School 2020 5th Period A Review Lesson On The Penis And The Vagina

  • censoredcreampiesquirtingZOZOsadistic villageZOZO-024ZOZO0241zozo00024
    • 2020-12-07
    51 min

    [gerk-335]ゆうか先輩

  • amateur censoredcreampiebig titsgerkgerk-335gerk335gerk-335
    • 2020-12-10
    76 min

    FC2PPV 1601240 [Hidden shooting] Blindfolded handcuffs sex with a 19-year-old slender metamorphosis amateur girl! There is a second round [Personal shooting of support [No.44]] [Review privilege: Another angle]

  • amateur uncensoredfc2
    • 2020-12-17
    182 min

    [JJBK-038]Mature Women Only: Take-Home Mature Woman Secretly Filmed And Used For Porn 36: 40-Something Nympho Wives Craving Dick Edition: Izumi, D-Cup, 40 Years Old, Aggressive MILF With Sexy Tan Lines & Kimiko, G-Cup, 44 Years Old

  • censoredcreampiemature womanJJBKjukujo bank emmanuellemanji groupJJBK-038JJBK038jjbk00038
    • 2020-12-18
    73 min

    [JTDK-025]Mila.A / TOKYODOLL White Pin-Up Girl Mila.A

  • mila a censoredcosplaybeautiful girlJTDKtokyodoll tvtokyo doll tokyodoll tvJTDK-025JTDK025h-1524jtdk00025
    • 2020-12-25
    239 min

    [MBM-250]The Other Side Of Karina Nishida BEST

  • nishida karina censoredanalcreampieMBMprestigejanhirombmMBM-250MBM250118mbm00250
    • 2021-01-22
    100 min

    [YST-237]My Sister's Obscene Mouth And Greedy Throat Are My Exclusive Mouth Pussies - Saya Minami

  • minami saya censoredcreampiedeepthroatYSTkomyoYST-237YST237540yst00237
    • 2021-02-05
    92 min

    [SS-014]All For You - Ibuki Aoi

  • censoredcreampieamateurSSplumSS-014SS014h-113ss00014
    • 2021-02-05
    87 min

    [lady-363]さな(22)

  • amateur censoredbig titsamateurladylady-363lady363lady-363
    • 2021-02-06
    120 min

    [SSNI-980]A Devilish Sugar Daddy Hunting Girl I Love My Boyfriend More Than Anything, But If It's For Money, I'll Turn On The Charm For A Middle-Aged Dirty Old Man And Fuck His Brains Out, And Here's The Footage To Prove It, From Start To

  • see the slope censoredbeautiful girlsingle workSSNIs1 no 1 stylemichiru arashiyamaSSNI-980SSNI980ssni00980
    • 2021-02-13
    39 min

    H4610 ki210214 Moe Serizawa 18years old

  • amateur uncensoredh4610
    • 2021-02-26
    77 min

    [hoi-162]みれい

  • amateur censoredamateurbeautiful girlhoihoi-162hoi162hoi-162
    • 2021-02-28
    103 min

    [VEC-467]The Married Woman Next Door Challenging My Virginity Dressed In Only Tiny Panties And A Front Hook Bra - Miku Maina

  • maina miku censoredcreampiebig titsVECvenuskaniemegami venusVEC-467VEC467vec00467
    • 2021-03-05
    60 min

    [NTTR-060]Once She Puts This Collar On Her Body Transforms？! Her Legs？! Her Ears？! Her Tits？! With Three Totally Different Erogenous Zones For Your Enjoyment, And Shuddering With Pleasure For Each In This Cosplay Photography Event! Rion Izumi

  • rion izumi censoredcreampiecosplayNTTRsod createhawk bijutsuknotriNTTR-060NTTR0601nttr00060
    • 2021-03-12
    92 min

    [DHT-240]Beautiful Lady Luring In A Married Woman With Money And Making Her Cheat On Her Husband Keiko 38 Years Old

  • censoredmarried womanamateurDHThot entertainmentblade take leeDHT-240DHT24059dht00240
    • 2021-03-18
    122 min

    [TOEN-039]Beautiful 40 Year Old Married Woman Succumbs To The Tongue Techniques Of Her Father-in-Law Shuka Sedzuki 40 Years Old

  • akihana sezuki censoredcreampiemarried womanTOENcenter villageyoichi sanotaoyuanTOEN-039TOEN039h-086toen00039
    • 2021-03-21
    119 min

    [CAWD-196]The Shyest Girl In My Class Draws The Naughtiest Pictures, But She's Never Gotten Laid Herself... I Got Time Alone With Her Under The Pretext Of Becoming Her Sketch Model While Studying After School And We Banged Liked Animals. Nenne Ui

  • first love censoredcreampiebig titsCAWDkawaiihirokoji osakiCAWD-196CAWD196cawd00196
    • 2021-04-08
    77 min

    [230OREC-738]うらら

  • amateur censoredcreampieuniformorecorec-738orec738230orec-738
    • 2021-04-10
    117 min

    [HOKS-094]Titties Soft Fruit Ripen To Perfection

  • mitsu hirose rina ayana akari nanara censoredbig titsmature womanHOKSfa prokinzo ogurokkuHOKS-094HOKS094hoks00094
    • 2021-05-01
    118 min

    [AMBI-125]My Secret Love Life With My Homeroom Teacher Mashiro Kisaragi

  • kisaragi mashiro censoredschoolgirlbeautiful girlAMBIplanet plusdirector oanbibaresotsuAMBI-125AMBI125h-237ambi00125
    • 2021-05-04
    128 min

    [STARS-368]She Went To Get Her First Thorough Checkup But The Evil Doctor Took Advantage Of Her ... This Office Lady Was Twitching And Trembling And Suppressing Her Cries Of Pleasure While She Dealt With The Disappointment Of Being Mistreated By Her

  • hikari aozora censoredcreampiesingle workSTARSsod createevening editionsod starSTARS-368STARS3681stars00368
    • 2021-05-06
    98 min

    [HONE-260]Soft Pressure And Squishy Squeezing! Groping My Step Mom's Titties Mako Oda

  • oda mako censoredcreampiebig titsHONEcenter villagesouthern earthhanazono center villageHONE-260HONE260h-086hone00260
    • 2021-05-07
    66 min

    230OREC-758 Hakucho

  • amateur censoredcreampiebig titsorecorec-758orec758230orec-758
    • 2021-05-08
    151 min

    [APKH-173]When I Messaged The Secret Account Of A Beautiful Rich Married Woman (27 Years Old) She Immediately Agreed To Fuck Me! Filming Hot And Steamy Sex With A Slutty Adulterous Wife Wearing A Thong Mia Hanesaki

  • mia hasaki censoredcreampieblowjobAPKHaurora project annexhaurora project anexAPKH-173APKH173apkh00173
    • 2021-05-22
    52 min

    FC2PPV 1831180 [God work] The result of renting the No. 1 active lady for one day … [Part 2]

  • amateur uncensoredfc2
    • 2021-06-16
    118 min

    [SSIS-098]Shared Room Fucking New Employee And Her Boss Have Adulterous Sex All Night During A Business Trip Mai Shiomi

  • mai shiomi censoredblowjobsingle workSSISs1 no 1 stylebungo maedaSSIS-098SSIS098ssis00098
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-06
    136 min

    [SDNM-293]My Japanese-American Ex-Model Wife Shigemori Aya , Age 30, Is The Most Popular Girl In Town - Final Chapter - She Feels Guilty But She Can't Resist The Pleasure Of A Stranger's Creampie

  • shigemori aya censoredcreampiemature womanSDNMsod createakira saijogenuine married woman the porn experienSDNM-293SDNM2931sdnm00293
    • 2021-07-08
    122 min

    [JRZE-061]First Time Filming My Affair Saki Oishi

  • saki oishi censoredcreampiemature womanJRZEcenter villageminami daichishoku ureJRZE-061JRZE061h-086jrze00061
    • 2021-07-14
    116 min

    [ROYD-063]This Big Stepbrother Was Too Much In Love With His Little Stepsister, So He Became An In-House Stalker ... And Now He Can No Longer Control Himself! She Tried To Resist, But He Injected Her Bushy Bush With 13 Consecutive Demonic Rich And Cr

  • momose asuka censoredcreampiesisterROYDroyalkawajirihhh groupROYD-063ROYD063royd00063
    • 2021-07-30
    142 min

    [HUNTB-073]Runaway girls are the best! I offered a runaway girl a place to stay and now my house is a gathering of runaway girls...

  • censoredcreampieschoolgirlHUNTBhunterborubo nakanohhh groupHUNTB-073HUNTB073huntb00073
    • 2021-08-04
    78 min

    FC2PPV 1954692 Hello! Project Honwaka Jd With One Experienced Person. Even Though I Have A Boyfriend, The First Vaginal Cum Shot Sex In My Life!

  • amateur uncensoredfc2
    • 2021-08-30
    40 min

    FC2PPV 2106129 First Shot! !! Limited Number! [Uncensored] Beautiful Proportions That Won The Former Beauty Pageant Grand Prix. Creampie On The Sensitive Body Of A Beautiful Woman Who Also Handles Fashion Models! !! (The Work That Was Scheduled To Be

  • amateur uncensoredfc2
    • 2021-08-31
    58 min

    KOUKAI-059 T-chan (Hasumi Takashi)

  • amateur censoredcreampieschoolgirlkoukaikoukai-059koukai059koukai-059
    • 2021-09-01
    55 min

    FC2PPV 2118996 [Slender Gymnastics Girls] Cuteness 1000 ♥ (21 Years Old) A Handsome Boyfriend And A Zokkon Soft Body Lady Although It Is Embarrassing, The Pussy Is Taken And Squirting Acme Love Love Convulsions Cum Shot Personal Shooting [Careful Han

  • amateur uncensoredfc2
    • 2021-09-02
    57 min

    413INST-154 [Personal Shooting] 21-Year-Old G Cup Amateur Layer Yuki-Chan Raw, Production, Seeding Sex So Much That I Have A Boyfriend

  • amateur censoredcreampiebig titsinstinst-154inst154413inst-154
    • 2021-09-09
    163 min

    [SUN-028]A Little Devil Plays Outdoors With The Semen Of An Older Man She Just Met Exhibitionist Ejaculation Control

  • rooster censoredbig titssingle workSUNsuntanaka baconSUN-028SUN02813sun00028
    • 2021-09-10
    120 min

    [SSIS-169]My Girlfriend"s Older Sister Is A Little Devil Who Will Creep Up From Behind And Whisper Dirty Talk Into My Ear While Tweaking My Nipples And Driving Me Crazy, While My Girlfriend Is Right There Beside Me Miru

  • miru censoredsquirtingslutSSISs1 no 1 stylesamoariSSIS-169SSIS169ssis00169
    • 2021-10-08
    98 min

    393OTIM-090 [Delusional Subjectivity] Pien-Based Kabukicho Slut Gal Ruru Arisu. (Ruru Arisu)

  • amateur censoredcreampieamateurotimotim-090otim090393otim-090
    • 2021-11-05
    300 min

    [DVDMS-734]A Normal Boys And Girls Focus Group Adult Video On The Other Side Of That One-Way Mirror Is His Beloved Wife! We Make A Husband"s Cuckold Fantasies Cum True In This Variety Special! On Their Anniversary, This Married Couple Was Shootin

  • censoredcreampieamateurDVDMSdeepsking of genkingthe magic mirrorDVDMS-734DVDMS734dvdms00734
    • 2021-11-06
    180 min

    [TPIN-016]Constantly Called Old Guy In C***dren"s Room...Mother-In-Law Is My Exclusive Sex Worker. Nozomi Haneda

  • nozomi haneda censoredcreampiemomTPINtsubakihoinTPIN-016TPIN016tpin00016
    • 2021-11-11
    205 min

    [STARS-440]絶頂開発 小柄なカラダをガクブル震わせながら激イキ!初めての巨根大絶頂3SEX MINAMO

  • minamo censoredSTARSsod createdainanasod starSTARS-440STARS440
    • 2021-11-13
    118 min

    [TIKP-063](The Fuck Log) When Ena Satsuki Gets Down To Party, She Unleashes Her Slut Aura Full Throttle, And That"s How We Filmed This POV Video!

  • ena satsuki censoredbig titssingle workTIKPchikichikiba gu mousozokuTIKP-063TIKP063tikp00063



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored