handjob beautiful girl javcensored jav amateur




FC2DASDNACRSTARSCESDMEYDDTTMIDEMIAAPPPDFSDSSWAAANACXAMBICJODLULUSDABNATRHODVATIDVEMA

2020-12-03
60 min

Pacopacomama 120320_393 Ryoko Asamiya

  • ryoko asamiya uncensoredcreampieblowjobpacopacomama
    • 2020-12-04
    123 min

    [ONEZ-264]Ms. Urara Just Wants To Get Licked: Two Kinky People Meet On A Fetishists' Hookup App For An Abnormal Lusty Battle Session: Urara Kanon

  • hanaoto urara censoredcreampieuniformONEZprestigetodoonezONEZ-264ONEZ264118onez00264
    • 2020-12-05
    104 min

    [ADN-281]Forbidden Immorality 5: A Too-young Mother-in-law Airi Kijima

  • airi kijima censoredsingle workdramaADNattackerssadao sadaokaotona no dramaADN-281ADN281adn00281
    • 2020-12-07
    44 min

    [ore-725]ユリ

  • amateur censoredcreampiebig titsoreore-725ore725ore-725
    • 2020-12-11
    172 min

    [MDBK-145]Smoking Hot Masseuse In A Barely-There Bikini Will Take You To Paradise

  • yuri yamagishi kiyomiya suzu censoredcreampiebig titsMDBKbazookarakudaMDBK-145MDBK145h-1496mdbk00145
    • 2020-12-20
    63 min

    413INST-080 [Gravure production outflow] Top secret personal photo session with that topical gravure idol

  • amateur censoredcreampiebig titsinstinst-080inst080413inst-080
    • 2020-12-25
    35 min

    FC2PPV 1620264 * Uncensored * ★ Spanish active model ★ BOF limited Rose-chan A passion covered with slimy oil F 〇 CK prat2 ♡

  • amateur uncensoredfc2
    • 2020-12-29
    40 min

    361SEKAO-140 Isabella from L.A

  • amateur censoredamateurbukkakesekaosekao-140sekao140361sekao-140
    • 2021-01-01
    134 min

    [EKDV-652]Natsu Tojo Makes Males Subs Cum Buckets! These Desperate Guys Plead To Get Off And Natsu Makes Their Dreams Cum True!

  • natsu tojo censoredcreampiesquirtingEKDVcrystal picturekintaro okumae kissEKDV-652EKDV65249ekdv00652
    • 2021-01-21
    62 min

    336KNB-138 The unsatisfactory wife who is full of premature ejaculation with tuna and her husband is light night applies for AV! In a position that I do not usually do, if I attack the back of the vagina that I can not reach normally, I will make a s

  • amateur censoredcreampiemarried womanknbknb-138knb138336knb-138
    • 2021-01-22
    240 min

    [ZOOO-019]Performances You Can Only Get Here! All Real Seductions! Sexy Tanned Thai Babes With Dazzling Smiles. 10 Girls, 4 Hours

  • censoredamateurZOOOzoooZOOO-019ZOOO019h-1515zooo00019
    • 2021-02-09
    60 min

    FC2PPV 1679338 ★ First shot amateur ☆ Active JD’s big pie Pochakawa ♥ Ringo-chan 20 years old ☆ G cup huge breasts erotic girl ♥ Super erotic rich blowjob ♥ The best pussy ever! Tokuno Creampie ♥ [Personal shooting] * With benefits

  • amateur uncensoredfc2
    • 2021-02-12
    119 min

    [IPX-615]Polite Dirty Talk - Massage Parlor Slut Sweetly Teases You With Her Lingerie - You Can't Leave Until You Cum Tsubasa Amami

  • amami tsubasa censoredcreampieslutIPXidea pocketzaku araidishIPX-615IPX615ipx00615
    • 2021-02-16
    83 min

    469G-637 Imadoki girls’ circle exchange (daddy activity) circumstances! Monami

  • amateur censoredcreampieuniformgg-637g637469g-637
    • 2021-02-19
    126 min

    [EVIS-337]Aphrodisiac Oil-Slathered Orgasms At The Erotic Lesbian Spa

  • suzuya strawberry tojo censoredsquirtinglesbianEVISebisusan mousouzokubyakkoEVIS-337EVIS337evis00337
    • 2021-02-19
    270 min

    [VPC-007](Aphrodisiac-Powered Sex With You, A Special Edition) Super Erotic Amateur Private Videos Are Being Leaked For Your Viewing Pleasure 07

  • censoredcreampiebig titsVPCprestigevideo podcastVPC-007VPC007118vpc00007
    • 2021-02-27
    90 min

    FC2PPV 1702653 Celebration! A total of over 20,000 thank-you projects! [Big Cock Big Mara Subordinate x Miraculous Beauty BODY Beauty and 3P] The daughter of the president’s daughter has also grown up w Drinking with 3 people and getting drunk a

  • amateur uncensoredfc2
    • 2021-03-05
    66 min

    [SZKK-015]My Step Sister Would Never...H

  • amateur censoredbig titssisterSZKKorustak softSZKK-015SZKK015
    • 2021-03-06
    209 min

    [HUNBL-035]Irrumatio x Creampie Sex x Bukkake G*******ging Sex This Bitchy Female Employee Is Always Hanging With The Guys And Doesn't Seem To Have An Ounce Of Sexuality, So We Made Her Suck Dick! And Have Creampie Sex! And Then We Bukkake Splatt

  • censoredcreampiedeepthroatHUNBLhuntercognac kaminohhh groupHUNBL-035HUNBL035hunbl00035
    • 2021-03-13
    47 min

    H0930 tk0030 Kiyo Namisaki 32years old

  • amateur uncensoredh0930
    • 2021-03-15
    46 min

    FC2PPV 1714617 Serika-chan ~ 5P Raw Creampie Orgy ~

  • amateur uncensoredfc2
    • 2021-03-20

    FC2PPV 1734672 Until 23 [Uncensored] Tall big breasts Sensitive JD shopping after cum shot

  • amateur uncensoredfc2
    • 2021-03-26
    243 min

    [NASH-473]Hot And Steamy Older Woman Soapland World Class Service From A Voluptuous Sexy Forty Something MILF

  • sachiko ono shinobu oshima censoredcreampiebig titsNASHnadeshikoNASH-473NASH473h-067nash00473
    • 2021-03-26
    230 min

    [DNW-114]Hooking Up In Seconds Flat!! Sudden Sex!! Instant Fucking & Instant Orgasms 4

  • censoredcreampiebig titsDNWprestigedocument nowDNW-114DNW114118dnw00114
    • 2021-03-26
    239 min

    [NASH-479]First Time Shots: Lewd, Beautiful Mature Women - Only Good Women Edition

  • censoredcreampiemature womanNASHnadeshikoNASH-479NASH479h-067nash00479
    • 2021-03-28
    56 min

    230OREX-234 Monami (I Cup)

  • amateur censoredcreampiebig titsorexorex-234orex234230orex-234
    • 2021-04-06
    45 min

    358WITH-094 Hinako (20) S-Cute With Tall Twinte Beauty And Creampie Gonzo SEX

  • amateur censoredcreampieamateurwithwith-094with094358with-094
    • 2021-04-08
    126 min

    [IENF-134]Amateur College Girl Babes Only! Would You Like To Experience Some Hard And Tight Coed Bathing In A Cramped Bathtub!？ See Her Body Burn With Lust! See Those Nip Slips! Enjoy Watching An Innocent Girl Blush With Excessively Bashful Teary Eye

  • hina hotaka karen anba censoredcreampieschoolgirlIENFienergytiger kosakaiienfIENF-134IENF1341ienf00134
    • 2021-04-09
    119 min

    [MIAA-422]The Girls I Work With Missed The Last Train Home So I Invited Them Over. Normally They're Well-Behaved, But Tonight They Go Wild And Start Pleading For My Seed Runa Tsukino Mikako Abe

  • tsukino luna abe mikako censoredslutMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-422MIAA422miaa00422
    • 2021-04-27
    51 min

    490FAN-050 Yui 1

  • amateur censoredcreampieamateurfanfan-050fan050490fan-050
    • 2021-05-01
    255 min

    [DVDMS-658]Escape From The One-Way Mirror Cab - Prim, Pretty Married Woman Variety Show Edition If These Amateur Girls Can't Get Their Friends To Switch Hit For Them Within 30 Minutes Of A Phone Call, They'll Have To Take A Quickie From An En

  • censoredcreampiemarried womanDVDMSdeepsking of genkingthe magic mirror mm mm flightsDVDMS-658DVDMS658dvdms00658
    • 2021-05-01
    120 min

    [NACR-417]A Video Record Of Sex With A Son's Wife That Day, My Kind And Gentle Father-In-Law Became A Rough Sex-Loving Demon Chitose Shinohara

  • chitose shinohara censoredbig titsmature womanNACRplanet plusbito sakurananakuruNACR-417NACR417h-237nacr00417
    • 2021-05-07
    147 min

    [MIFD-157]Dream Chasing Virgin Amateur Makes Her Idol Porn Debut! Himari Ayase

  • himari ayase censoredsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-157MIFD157mifd00157
    • 2021-05-11
    136 min

    [STARS-373]Breaking In Her Teacher: "Do You Like To Have Your Nipples Teased, Teacher？" My S*****t Kaede Whispered In My Ear While She Stroked My Nipples. Kaede Hiiragi

  • hiiragi kaede censoredbeautiful girlsingle workSTARSsod createkisshisod starSTARS-373STARS3731stars00373
    • 2021-05-12
    33 min

    FC2PPV 1814821 May limited 1000 [None] A debt wife with a sensitive and beautiful skin. She finds shoplifting and she is taken to a public toilet and vaginal cum shot is made continuously.

  • amateur uncensoredfc2
    • 2021-05-13
    160 min

    [ABW-091]綺麗なお姉さんの完全エスコートSEX 年下くんを性の悩みから解放するドキュメント 松岡すず 【MGSだけのおまけ映像付き 20分】

  • amateur censoredamateurcosplayabwabw-091abw091abw-091
    • 2021-05-29
    130 min

    [ARAN-022]The Strong Orgasms After Having Sex With You Research Center A Female Bodily Transformation Project Using Secret Sexual Toys And Authentic Aphrodisiacs Project-2 We Met This Office Lady Who Works At A Financial Firm At A Bar So We Seduced H

  • censoredcreampieARANbabyentertainmentshiroto musume kyoso kyokuARAN-022ARAN022aran00022
    • 2021-06-04
    119 min

    [BBAN-328]"But Still...I Don't Love You" Ravished By The Female Coworker I Hate... Hijiri Maihara Yui Hatano

  • kiyoshi maihara yui hatano censoredlesbiandramaBBANbibianBBAN-328BBAN328bban00328
    • 2021-06-12
    119 min

    [NASH-523]Congrats On Her 60th Birthday! The Bubble Economy, The Recession, The Tsunami... Mature Cougar Born In 1961 Has Survived The Ups And Downs Of Life... And Now She's Horny

  • censoredmature womanNASHnadeshikoNASH-523NASH523nash00523
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-07
    61 min

    FC2PPV 1910095 * Limited time price * Until 7/13 [2480PT⇒1980PT] Super chewy! !! Too cute beauty big tits J 〇 18 years old Uncle overweight gets vaginal cum shot

  • amateur uncensoredfc2
    • 2021-07-17
    125 min

    [CAWD-247]Kawaii-type actress Miina Konno meets a Director Samoari. She awakens to sweet sadism! You're gonna get it! Nipple orgasm special

  • miina konno censoredsluthandjobCAWDkawaiisamoariCAWD-247CAWD247cawd00247
    • 2021-07-22
    76 min

    FC2PPV 1935700 * Price Will Be Raised On 7/26 1980pt → 3980pt [Appearance] [Uncensored] 3P Gonzo! A 25-Year-Old Office Lady Who Works At A Trading Company Is Super Beautiful, Has Beautiful Breasts, Smooth Skin, And Thin Hair Is Too Erotic! Blow And H

  • amateur uncensoredfc2
    • 2021-09-17
    81 min

    [sqb-119]えま(20)

  • amateur censoredbig titsamateursqbsqb-119sqb119sqb-119
    • 2021-09-17
    122 min

    [TPPN-204]Older Guy From Around The Town Meets Beautiful Girl With Innocent Face. Doll-like Purity As A Plaything. Hairless Pussy Is Wet For Adult Sex. Ichika Matsumoto

  • ichika matsumoto censoredbeautiful girlsingle workTPPNteppanTPPN-204TPPN204tppn00204
    • 2021-09-24
    222 min

    [HUNTB-103]My Perverted Distant Cousin Loves Sucking Me Off And Won"t Let Go When She"s Between My Legs! It"s The First Time Meeting Her In Many Years After Growing Up. She Still Looks Innocent

  • censoredcreampieschoolgirlHUNTBhunterkonnyaku kannohhh groupHUNTB-103HUNTB103huntb00103
    • 2021-10-09
    238 min

    [NASH-586]A Married Woman Betrays Her Husband "Dear, Please Forgive Me, I Just Wanted Some Excitement" Best Hits Collection 4 Hours

  • censoredcreampiemature womanNASHnadeshikoNASH-586NASH586nash00586
    • 2021-10-20
    28 min

    FC2PPV 2360111 * First Public Release [Complete Appearance] FC2’s Highest Model-Class Beautiful Girl Jd In History. She Has Two Undesired Vaginal Cum Shot To The Uterus That Keeps Cumming. She Ejaculated A Total Of Four Times A Day. * High Image

  • amateur uncensoredfc2
    • 2021-11-06
    60 min

    10musume 110621_01 G Cup Net Dress Girl Who Cums Many Times Nami Minami

  • amateur uncensored10musume
    • 2021-11-19
    110 min

    [VEMA-172]Beautiful Female Teacher"s Girlfriend Is My Class Homeroom Teacher, Club Advisor, And My Lover - Forbidden Passionate Creampie Sex With Older Girlfriend From Morning Till Night - Kana Morisawa

  • kana morisawa kanako iioka censoredcreampiemature womanVEMAvenuskaniemegami venusVEMA-172VEMA172vema00172
    • 2021-11-23
    43 min

    C0930 ki211123 Makiko Ootake 45years old

  • amateur uncensoredc0930
    • 2021-11-23
    51 min

    FC2PPV 2457158 The Uncle’s Popular [Cosmetology Beauty Salon Receptionist] Was Persuaded By The Elderly Four Times And Went Into The Car On A Rainy Day. I’M Stunned By The Dopply Oral Ejaculation …

  • amateur uncensoredfc2
    • 2021-12-03
    240 min

    [CLUB-661]We Went Picking Up Girls And Took Home This Friendly Pair Of Girls We Met At An Izakaya. If We Quietly Have Sex, Will Their Tight-Legged Friends In The Next Room Get Horny And Let Us Fuck Them Too？ 29

  • censoredsquirtingCLUBhentai gentleman clubCLUB-661CLUB661club00661
    • 2021-12-04
    136 min

    [DAYA-017]Gal Model Himari (25 Years Old) Has Middle-Aged Guy By The Balls Himari Kinoshita

  • himari kinoshita himari hanazawa censoredblowjobslutDAYAdigital arkyumeno aidadigital ark dejitarua kuDAYA-017DAYA017daya00017
    • 2021-12-13
    53 min

    229SCUTE-1156 Karen (20) S-Cute Overflowing Beauty Big Tits X Swaying Nice Ass Is Too Erotic Etch (Karen Asahina)

  • amateur censoredbig titsamateurscutescute-1156scute1156229scute-1156
    • 2022-01-07
    175 min

    [NKKD-241]This is My Wife (33) Getting Fucked by My Part Time Employee (20, virgin) -> It was Hard on Me, so Please Release this AV as is. (Virgin Hunter Series).

  • censoredbig titsNKKDjet eizomanji groupNKKD-241NKKD241nkkd00241



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored