high 144




FC2VENXAMBICHRVGMEMLULUSANAUKGPREDMVSDVEMAAWDPPPDGVHHDKAVENUNACRAUKSCESDHMNIPX

2021-01-09
65 min

SIRO-4345 [First shot] [Screaming baby-faced girl] [Powerful nice ass cowgirl] A pure female college student who still has the innocence of a girl. If you advance to the extent that the developing beauty man is about to break, the girl will panting w

  • amateur censoredamateursirosiro-4345siro4345siro-4345
    • 2021-01-09
    138 min

    [JUFE-249]I Lost Control When Our Parents Were Off On Their Honeymoon And Wound Up Fucking My Younger Stepsister - Memories Of Youth. Miu Narumi

  • narumi miu censoredschoolgirlblowjobJUFEfitchJUFE-249JUFE249jufe00249
    • 2021-01-15
    240 min

    [MBM-256]An Amateur Seduction Documentary Super Selections! You Can Tell She's Got Big Tits, Even With her Clothes On, And She's Super Cute To The Max! And She's Just As Horny As Her Titties Are Big 12 Beautiful Big Tits Girls 4 Hours

  • censoredbig titsamateurMBMprestigegaro sasazukambmMBM-256MBM256118mbm00256
    • 2021-01-15
    80 min

    259LUXU-1365 Luxury TV 1353 A beautiful woman dating a wealthy man “to find a man who will satisfy me …” urgently participates in AV shooting! A plump body with plump breasts and buttocks has good sensitivity! Exposing this body in fro

  • amateur censoredbig titsamateurluxuluxu-1365luxu1365259luxu-1365
    • 2021-01-15
    240 min

    [NASH-434]A Married Couple's Real Sex Life vol. 03

  • nozomi maezono asahi nishiyama censoredmarried womanmature womanNASHpinknadeshikoNASH-434NASH434h-067nash00434
    • 2021-01-24
    125 min

    [WTFK-001]Huge Tits Training Masochistic Sacrifice - Yuko Ayanami

  • rei ayanami censoredcreampiebig titsWTFKtoyohikozarakiseiunkaiWTFK-001WTFK001wtfk00001
    • 2021-01-24
    125 min

    [CESD-972]Tearful Non-Stop Orgasmic Sex 4 - Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiemature womanCESDceleb no tomoCESD-972CESD972cesd00972
    • 2021-01-26
    101 min

    261ARA-475 [Super sullen class] 30 years old [Domazo wife] Mako-san is here! The reason for her application, which is out of stock at the supermarket, is “I want to save navel chestnuts …” AV appearance in secret to her husband! [Slend

  • amateur censoredmarried womanamateuraraara-475ara475261ara-475
    • 2021-02-01
    120 min

    [NACR-391]At-Home Adultery With My Husband's Brother Matsuri Nichinan

  • nichinan festival censoredblowjobmature womanNACRplanet plusbito sakurananakuruNACR-391NACR391h-237nacr00391
    • 2021-02-11
    136 min

    [NEO-753]Armpit Sweat And Semen - Tsukasa Nagano

  • tsukasa nagano censoredsingle workNEOradixshio sakurabaneo paradoxNEO-753NEO753433neo00753
    • 2021-02-15
    340 min

    [YPTS-002]Big Tits Cosplayer Creampie: Sucking Self-shoot

  • censoredcreampiebig titsYPTSpetersYPTS-002YPTS002h-021ypts00002
    • 2021-02-21
    121 min

    [DASD-819]In My Job-hunting Resume... When I Wrote "Small Breasts" In My List Of Advantages, I Was Called Into Another Room. Risa Shiroki

  • risa shirojo censoredbeautiful girlsingle workDASDdaskirinDASD-819DASD819dasd00819
    • 2021-03-06
    158 min

    [BF-627]I Was Jealous Of My Classmate, Who Was Dating A College S*****t ... So While My Classmate Was At Home, I Spent 2 Days And A Night Furiously Fucking Her Boyfriend. Asuka Momose

  • momose asuka yuuri censoreduniformschoolgirlBFbefreeroku yonBF-627BF627bf00627
    • 2021-03-12
    57 min

    [CLO-134]I'm With A GothLoli Barely Legal Babe Who's Cute As A Doll ... Yui Nagase (Not Her Real Name)

  • yui nagase censoredsquirtingcosplayCLOchobitchchovicCLO-134CLO134h-1435clo00134
    • 2021-03-18
    220 min

    [HUNTA-971]"Please Untie Me ... This Is So Embarrassing" I Tied Up My C***dhood Friend In Special Knots That Are Impossible To Untie By Herself, And I Put Her In The Paradise Lock Position, And When I Saw Her Thrusting Her Super Erotic Ass Ou

  • censoredschoolgirlHUNTAhuntergorilla butahhh groupHUNTA-971HUNTA971hunta00971
    • 2021-03-21
    55 min

    490FAN-067 China 2

  • amateur censoredcreampieamateurfanfan-067fan067490fan-067
    • 2021-03-25
    61 min

    336KNB-147 NTR Appeared In AV Begged By Her Hobby Husband! Sloppy yoga in intense SEX that you can not usually do! My husband will surely be overjoyed win-win vaginal cum shot! I will take a gonzo with this married woman from now on. 42 at Kawaguchi

  • amateur censoredcreampiebig titsknbknb-147knb147336knb-147
    • 2021-03-27
    58 min

    476MLA-034 [Daddy activity infiltration, Echika-chan edition] Blow face in love ☆ Mekkawa 19 years old Apparel clerk is a sensitive slender body with extremely high face level! Change into obscene lingerie and have convulsions guck gaku big cum! Two

  • amateur censoredcreampieamateurmlamla-034mla034476mla-034
    • 2021-04-01
    120 min

    [NACR-407]My Mother-in-law Is A Reader Model Misuzu Kawana

  • misuzu kawana censoredcreampiesingle workNACRplanet plusbito sakurananakuruNACR-407NACR407h-237nacr00407
    • 2021-04-09
    167 min

    [MIFD-153]I Want To Draw My Own Sex! Fresh Face Porn Debut - Cute & Boyish Mai Kagari, Age 20

  • flower hunting censoredbeautiful girlsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-153MIFD153mifd00153
    • 2021-04-10
    154 min

    [CESD-991]We Film Whatever Kana Morisawa Wants To Do Kana Morisawa

  • kana morisawa kanako iioka censoredcosplaymature womanCESDceleb no tomoCESD-991CESD991cesd00991
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-04-29
    195 min

    [ABW-085]【MGSだけのおまけ映像付き 15分】女子マネージャーは、僕達の性処理ペット。 039 八掛うみ

  • amateur censoredamateurbukkakeabwabw-085abw085abw-085
    • 2021-05-22
    127 min

    [CEAD-339]I'm A Nympho Masturbator Who's Gone Crazy From Pleasure Ayaka Mochizuki

  • ayaka mochizuki censoredsquirtingmature womanCEADceleb no tomoCEAD-339CEAD339cead00339
    • 2021-05-26
    56 min

    SIRO-4485 [First shot] [Pure white beauty body] [Burning soft skin] 19 years old who is good at begging for sweetness. Around the age when a boxed girl who goes to a female college is also interested in sex .. Application amateur, first AV shooting 2

  • amateur censoredamateursirosiro-4485siro4485siro-4485
    • 2021-06-10
    19 min

    Caribbeancom 061021-001 Pussy Encyclopedia: Non Suzumiya

  • non suzumiya uncensoredcaribbeancom
    • 2021-07-01
    58 min

    FCP-026 [Delivery Only] Muchipuri Best Ass Job! !! ＃ 1 I’ll make you feel good with my big ass …! !!

  • amateur censoredamateurbeautiful girlfcpfcp-026fcp026fcp-026
    • 2021-07-02
    63 min

    383REIW-078 Tsumurin

  • amateur censoredamateurbeautiful girlreiwreiw-078reiw078383reiw-078
    • 2021-08-02
    44 min

    326HGP-018 [Alps-Class Boobs Mountains] Transcendental H Cup! !! The Sensitivity Of The Girls With A Super Flesh-Like Plump Body Suddenly Rises Due To Drunkenness! A Lewd Busty Beauty Who Keeps Half Asleep And Cums Inside! !!

  • amateur censoredcreampieamateurhgphgp-018hgp018326hgp-018
    • 2021-08-06
    68 min

    FC2PPV 1961075 ☆ New Half Price Until 8/15 ♡ 1980⇒990 [No / Piece] G Cup When You Take It Off! 21-Year-Old College Student With Transcendent Beauty Big Tits ♡ As Soon As I Insert A Dick, I Can Not Stand It And The Husky Voice Echoes And It Warps And

  • amateur uncensoredfc2
    • 2021-08-13
    146 min

    [RKI-617]This Lady Boss With A Big And Beautiful Ass Is Luring Her Employees To Temptation And Giving Them An Exquisite Cowgirl Joyride And Enjoying Deep Pussy-Drilling Sex Mikako Horiuchi

  • mikako horiuchi censoredsluthandjobRKIrookieRKI-617RKI617rki00617
    • 2021-08-20
    151 min

    [CAWD-260]A Wife Who Was Made To Repay Her Beloved Husband"s Debts That He Incurred From A Black Market Dealer With Creampies - Moko Sakura

  • sakura moko censoredcreampiesingle workCAWDkawaiikimura hiroyukiCAWD-260CAWD260cawd00260
    • 2021-08-30
    118 min

    [RD-1072]Filthy Sex Drama From The Showa Era Playboy Groom Fucks His Wife"s Mother Former Teacher Plots Sexual Conquest In The House Of His Married Former Schoolmate

  • yuri satsuki yoko yamashita censoredmarried womanblowjobRDatena eizouRD-1072RD1072
    • 2021-09-03
    120 min

    [JBD-273]The Female Doctor, A Beautiful Woman, Is Sorry She Made A House Call. Miki Maeshima

  • miki maejima censoredsingle workJBDattackerskanou hanahebi bakuJBD-273JBD273jbd00273
    • 2021-09-29
    239 min

    [IBW-840]A Dirty Old Man"s Video Record Collection Of Harlem Sex With Beautiful Girl Babes 4 Hours

  • amateur censoredbeautiful girlIBWi b worksIBW-840IBW840
    • 2021-10-07
    51 min

    527SROC-016 Mari 2 (Mari Takasugi)

  • amateur censoredamateursrocsroc-016sroc016527sroc-016
    • 2021-10-09
    135 min

    [CEMD-065]Feeling It Too Much And Wetting Myself a Lot. Excuse Me...Vol. 30, Mina Kitano

  • mina kitano censoredbig titssquirtingCEMDserebu no tomoCEMD-065CEMD065cemd00065
    • 2021-10-14
    179 min

    [ZOKU-021]First Time Shots, Satomi Nagasawa, 38 Years Old, Adult Video Debut, Satomi Nagasawa

  • satomi nagasawa censoredmature womansingle workZOKUtakara eizoumimasaka shuntakaraZOKU-021ZOKU02118zoku00021
    • 2021-10-15
    95 min

    [VENX-084]Mistakenly Inserted In My Mother-In-Law, Mistaking My Mother-In-Law and My Wife"s Ass. Kimishima Mio

  • kimishima mio censoredcreampiebig titsVENXvenuskitano majimeincest vi nasuVENX-084VENX084venx00084
    • 2021-10-21
    33 min

    FC2PPV 2363197 Until Today! Appearance! "# 6-2" Company Clerk. Creampie While Letting Her Loved Woman Say "I Like It. I Love It". ♡ Both Feelings ♡

  • amateur uncensoredfc2
    • 2021-10-27
    60 min

    SIRO-4650 [First Shot] [Continuous Cum] [Obvious Pant Voice] A Half-Faced Professional Student Who Aims To Become A Cook Appears. The Girl Who Answered The Interview Innocently, She Fluttered Like Crazy With A Cock That Pierced Violently Many Times .

  • amateur censoredamateursirosiro-4650siro4650siro-4650
    • 2021-11-04
    119 min

    435MFC-156 ["Please Sperm Me Too ♪" Impure Physical Relationship With Big Breasts Teacher] Affair Etch Without Waiting For Family Collapse With My Son’S Teacher ♪ Excellent Sensitivity M Temperament Does Not Stop The Tide! !! Condom Conf

  • amateur censoredcreampiebig titsmfcmfc-156mfc156435mfc-156
    • 2021-11-06
    70 min

    318LADY-392 Mitsuki (Nagisa Mitsuki)

  • amateur censoredcreampieamateurladylady-392lady392318lady-392
    • 2021-11-11
    63 min

    H0930 ki211111 Noriko Fujimoto 29years old

  • amateur uncensoredh0930
    • 2021-11-12
    144 min

    [MVSD-488]Temptress Kissing Harem Slurps Up Old Man"s Essence With Passionate Kisses And Lots of Saliva! Reverse 3P Juicy Lip Sandwich Makes His D*ck Swell Satsuki Mei Momose Asuka

  • satsuki mei momose asuka censoredcreampiebeautiful girlMVSDm s video groupsamoarims video groupMVSD-488MVSD488mvsd00488
    • 2021-11-12
    177 min

    [BLK-537]No Need For Condoms Or Sunscreen! AV Debut of Beach Happiness Slut That Takes The D*cks of The Beach House Part-Timers Hamabe Anna

  • anna beach censoredcreampieblowjobBLKkira kirazampakira hosi kira black galBLK-537BLK537blk00537
    • 2021-11-20
    240 min

    [OKAX-797]Pussy Sopping Wet With Lewd Juices! Anal Twitching Masturbation

  • hikaru minazuki nimo censoredOKAXk m produceokazuOKAX-797OKAX797okax00797
    • 2021-11-27
    240 min

    [JKSR-519]Party Time x Picking Up Girls x Sex! 12 Ladies 4 Hours Hey Lady, Would You Like To Party With Me？ BEST HITS COLLECTION @Shinjuku Local Married Woman Babes Only We Seduced Married Woman Babes Who Seemed To Have Issues And Were Hanging Out At

  • censoredmarried womanamateurJKSRbig mocalobockeypink junkieJKSR-519JKSR51957jksr00519
    • 2022-01-01
    106 min

    [SQTE-398]This Bitch Is Crazy!! A Beautiful Girl With Short Hair Is Enjoying Teary-Eyed Sex Nana Hayami

  • don t be quick censoredsquirtingblowjobSQTEs cuteSQTE-398SQTE398sqte00398
    • 2022-01-07
    111 min

    [VENX-106]"You"re Riding My Tits." Taking A Bath And Having Sex With My Busty Mother-in-law, Who Is Really My Type. Yukari Orihara

  • yukari orihara censoredcreampiebig titsVENXvenuskaniefakecest winntersVENX-106VENX106venx00106
    • 2022-01-14
    59 min

    [011422-001]Wealthy man"s hobby : Compete which one is much erotic

  • amateur uncensoredcreampiecaribbeancom
    • 2022-01-26
    47 min

    292MY-514 Naomi Yoshii 2

  • amateur censoredmarried womanamateurmymy-514my514292my-514
    • 2022-01-27
    167 min

    [NHDTB-622]夫の横で痴●され腰をクネらせ発情した妻は自らチ○ポを求めて無言でイキまくる

  • censoredslutNHDTBnatural highjaken kodamaNHDTB-622NHDTB6221nhdtb00622
    • 2022-01-28
    239 min

    [GODR-1053]Hardcore Masturbation: 4 Hours Of 8 Top-class Blonde-haired Beautiful Girls - Japanese Cocks Are The Best, Aren"t They

  • censoredamateurGODRtriple hhasshigodGODR-1053GODR105378godr01053
    • 2022-02-07
    43 min

    FC2PPV 2651885 [None] [Limited To 100 Pieces 2980 → Off To 1480pt!] Now The Topic Of Tax ○ Beautiful Legs Working At The Office ♥ ️ Urgent Release! The Last Shock Problem Work! We Do Not Know When It Will Be Deleted, So We Recommend Purchasing It As

  • amateur uncensoredfc2
    • 2022-02-18
    120 min

    [SSIS-330]I Want To Be Between Such Colossal Tits... Men Cannot Stand This Titty Fuck. A Bitch With Hot Tits Who Makes Cocks All Hard And Wet - Mei Washio

  • mei washio censoredbig titsslutSSISs1 no 1 stylegoemonSSIS-330SSIS330ssis00330



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored