high 194




FC2ONEZNGODHNDROYDNATRATIDDASDHMNVEMAWAAAAWDNNPJNACREBODSANPPPDSHKDBLKHDKAHZGD

2021-01-01
60 min

HEYZO 2428 Discrete Maid Is Ready For Naughty Care Vol.11 – Emi Aoi

  • emi aoi uncensoredcreampieblowjobheyzo
    • 2021-01-11
    42 min

    362SCOH-031 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [Ze ● Two]

  • amateur censoredcreampieamateurscohscoh-031scoh031362scoh-031
    • 2021-01-12
    83 min

    [BTHA-058]Hairy Nude - Non-edited Baby Faith Beautiful Tits, Slender Body Miku Abeno

  • miku abeno censoredBTHAsupa kubijonBTHA-058BTHA058
    • 2021-01-16
    184 min

    [DVDMS-624]A Normal Boys And Girls Focus Group Survey Adult Video "Can You Please Let In A Cherry Boy!？" These College Girl Babes Were Having A Girls' Night Out At A Love Hotel x A Big Dick Cherry Boy This Cherry Boy Gets An Erection Just

  • censoredbig titsamateurDVDMSdeep ssoterberghDVDMS-624DVDMS624dvdms00624
    • 2021-01-23
    69 min

    200GANA-2420 Seriously Nampa, first shot. 1586 Get a gal who is cheating on a man in dating! The best blowjob maximizes comfort! Shaved Oma ● Every time you make a piston, it tightens powerfully as if it expresses comfort! This is my uncle’s bes

  • amateur censoredamateurganagana-2420gana2420200gana-2420
    • 2021-02-19
    128 min

    [SORA-296]A Serial Infidelity-Committing Wife A Miraculous 45-Year-Old Beautiful Bewitching Bitch Who Is Still In The Game, Cumming Down To Bless Us All! She's Forgetting All About Her Husband And Going On A 2-Day, 1-Night Adultery Trip With Her

  • censoredSORAyama to sorahimu lockSORA-296SORA296sora00296
    • 2021-03-01
    122 min

    [MARA-058]Yua Makura's Colossal Tits Theater: K-cup! 116cm

  • yu asakura censoredbig titssingle workMARAplanetdirector omaracasMARA-058MARA058h-237mara00058
    • 2021-03-04
    58 min

    FC2PPV 1711670 [4K shooting] [Again again] Active model beautiful legs beauty ❤ Rich blowjob ♪ On the verge of ejaculation at the woman on top posture w Screwed to the back of the vagina Raw vaginal cum shot ejaculation! !!

  • amateur uncensoredfc2
    • 2021-03-06
    125 min

    [JUL-493]S******g Her Way To The Top With NTR Lust - A Dedicated Wife Is Supporting Her Beloved Husband With Horny Hospitality - Mayuka Kitagawa

  • mayuka kitagawa censoredbig titsmature womanJULmadonnajotaro tomiJUL-493JUL493jul00493
    • 2021-03-13
    119 min

    [MIDE-890]The Captured Female Detective Aphrodisiac Oil Orgasmic Hell Mizuki Aiga

  • mizuki ai censoredcreampiesingle workMIDEmoodyztrendy yamaguchimoodyz divaMIDE-890MIDE890mide00890
    • 2021-03-15
    72 min

    FC2PPV 1721361 [Individual] Slender intellectual beautiful wife, intelligent tax accountant, 50 years old, accident-level screaming crying Gonzo with pleasure to break [First special price]

  • amateur uncensoredfc2
    • 2021-03-21
    60 min

    413INST-106 After all raw feels good! Swimming club JD Maina-chan (20) who is addicted to sex without rubber If the nipple is too weak and cramped, it will be intensely iki vagina Kyun convulsions stop )

  • amateur censoredcreampieamateurinstinst-106inst106413inst-106
    • 2021-03-21
    146 min

    [CAWD-195]I Like The Big Ones - Kinky Slut Loves Huge Cocks - Juno Sakai, Age 20, Gets A Sperm Injection From The Kind Of Monster Schlong She's Been Dreaming Of - Her First Creampie

  • sakai juno censoredcreampiesquirtingCAWDkawaiilamb chopCAWD-195CAWD195cawd00195
    • 2021-03-26
    62 min

    326PAPA-026 [Daddy activity infiltration, Emily-chan edition] Only one experienced person ☆ A wealthy boxed daughter awakens her vagina with 180 degrees wide open legs! Creampie with a demon piston that breaks the old-fashioned idea of chastity! !!

  • amateur censoredcreampieamateurpapapapa-026papa026326papa-026
    • 2021-03-27
    80 min

    491TKWA-063 A Noh Weather Girl’s Minimum Female College Student Who Says "If You Have Fun In Life, It’s okay!"

  • amateur censoredcreampieamateurtkwatkwa-063tkwa063491tkwa-063
    • 2021-03-29
    38 min

    362SCOH-041 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [I ● Ya] Ayame Hina

  • amateur censoredcreampieuniformscohscoh-041scoh041362scoh-041
    • 2021-04-09
    720 min

    [NVT-001]【期間限定販売】ナンパTV PREMIUM BEST 1 ガチナンパで激エロ美女を大漁捕獲！！街中に溢れるシロウト娘をナンパしハメまくるリアルドキュメント！！

  • amateuramateur censoredamateurnvtnvt-001nvt001nvt-001
    • 2021-04-09
    130 min

    [MUKC-016]Squirting Nanase Asahina Asahina Nanase

  • asahina nanase censoredcreampiesquirtingMUKCmukuinnocent cosplayMUKC-016MUKC016mukc00016
    • 2021-04-16
    80 min

    FC2PPV 1773451 Active teenager. She has a transparent uniform and a lot of facial cumshots on a fair-skinned beautiful girl with a baby face.

  • amateur uncensoredfc2
    • 2021-04-22
    106 min

    [SPRD-1400]My Stepson - Horny Stepson And The Stepmom Who Can't Help Fucking Him Sumire Shiratori

  • shiratori shiratori censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1400SPRD140018sprd01400
    • 2021-04-24
    151 min

    [MMKZ-095]Her Filthy Booty's So Fine It Made Me Lose My Mind! Himari Kinoshita

  • himari kinoshita himari hanazawa censoredsingle workMMKZmarrionkojiro miyamotoirisMMKZ-095MMKZ095mmkz00095
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-04-27
    132 min

    [PAIS-002]Plain Jane Girl With Big Tits Who Came To Tokyo From The Countryside She Makes Her Porn Debut On The Same Day She Enters College

  • censoredbig titsamateurPAISmercurychabozu tea boypie otsukai day clubPAIS-002PAIS002h-1133pais00002
    • 2021-05-05
    84 min

    259LUXU-1426 Luxury TV 1400 An Innocent President’s Daughter And President’s Secretary With One Experienced Person Appears In AV To Know The Outside World! The outstanding glamorous body that is disproportionate to the cute looks that seem

  • amateur censoredbig titsamateurluxuluxu-1426luxu1426259luxu-1426
    • 2021-05-05
    115 min

    [LOL-194]Blowjob Specialist: Recorded Video Of A Devilish Step-uncle Who Fucks His Step-niece Mao When She Comes Home - Mao Watanabe

  • mao watanabe censoredcreampieblowjobLOLglay zloli senkaLOL-194LOL19412lol00194
    • 2021-05-07
    163 min

    [MUDR-148]Young 145cm Tall Girl Delivered To Your Doorstep Are You Okay With Me？ Nae Sakuragi

  • nae sakuragi censoredcreampieuniformMUDRmukuMUDR-148MUDR148mudr00148
    • 2021-06-10
    39 min

    361SEKAO-155 Courtenay Taylor from L.A

  • amateur censoredamateursekaosekao-155sekao155361sekao-155
    • 2021-07-09
    52 min

    ZOCT-011 Monami (Pornstar Name)

  • amateur censoredcreampieamateurzoctzoct-011zoct011zoct-011
    • 2021-07-27
    120 min

    [SAN-011]I Let My Manager With The Big Dick Fuck Me At My Part Time Job -Shion Nagisawa

  • nagisawa shion censoredcreampiebig titsSANmothermother motherSAN-011SAN011h-796san00011
    • 2021-08-12
    121 min

    [DLDSS-022]Situation Reversal! I Invited A Call Girl Over, But It Was My Annoying Boss. Ayaka Tomoda

  • ayaka tomoda censoredsingle workdramaDLDSSdahliajounetsu yakaraDLDSS-022DLDSS0221dldss00022
    • 2021-08-18
    62 min

    [ikuiku-005]りな(20)

  • amateur censoredcreampiesquirtingikuikuikuiku-005ikuiku005ikuiku-005
    • 2021-08-20
    116 min

    [HZGD-197]Homestay Guy Fucks Beautiful Scandinavian Wife With Big Tits Lily Hart

  • lily heart censoredcreampiebig titsHZGDhitodzuma hanazono gekijouzampaHZGD-197HZGD197h-1100hzgd00197
    • 2021-08-28
    41 min

    [PSST-032]These Japanese Cocks Are Going To Fuck The Shit Out Of These Celebrity Mature Woman Babes! See Her Drool With Deep Throat Orgasmic Pleasure! Nina Nina Hartley

  • nina hartley censoredmarried womanamateurPSSTpatzkin amateurbooker tPSST-032PSST032h-1450psst00032
    • 2021-09-10
    147 min

    [SSIS-173]*Completely Uned! POV! No Makeup! Anything Goes! Talented Beauty Tsubaki Sannomiya"s All-Natural, Real Carnal Instincts Caught On Camera! Genuinely Intimate Sex At A Couple"s Hot Spring Trip - Fresh, Vivid, 200 Erotic Ultra-Rare Foo

  • sannomiya tsubaki censoredbeautiful girlsingle workSSISs1 no 1 stylearashiyama michiruSSIS-173SSIS173ssis00173
    • 2021-09-10
    177 min

    [IPX-722]The End Of Abstinence: For 3 Days, Covered With Sweat And Climax Juices - Hikari Azusa

  • azusa hikari censoredsquirtingbeautiful girlIPXidea pocketinaballdishIPX-722IPX722ipx00722
    • 2021-09-18
    138 min

    [OMHD-011]A Stalker-Like Porn Director Sets Off On A Journey With A Porn Actress. Hinako Mori

  • hinako mori censoredblowjobsingle workOMHDdogmaoota migiwaOMHD-011OMHD011omhd00011
    • 2021-09-23
    122 min

    [DLDSS-026]Mission: Cumpossible The Soothing Semen Hunter Rin Azuma

  • dongguan censoredblowjobsingle workDLDSSdahliajounetsu yakaraDLDSS-026DLDSS0261dldss00026
    • 2021-10-09
    167 min

    [TPIN-014]How About Skipping Work and Taking Part in a Porn Shoot？ It Was Her Second Year Working at the Bookstore. Aya Aoyama (Pseudonym, 24 Years Old)

  • censoredcreampieamateurTPINtsubakihoinTPIN-014TPIN014tpin00014
    • 2021-10-09
    138 min

    [CEAD-370]Ema Kuon"s One Off Adult Debut: Her First Time Experiencing Total Climax And Trembling From A Massive Cock!

  • emma kuon censoredblowjobmature womanCEADserebu no tomoCEAD-370CEAD370cead00370
    • 2021-10-19
    58 min

    Caribbeancom 101921-001 Luxury Adult Healing Spa: There Is Nothing Better Than Slow Passionate Sex Yuna Sasaki

  • yuna sasaki uncensoredcreampiecaribbeancom
    • 2021-10-22
    119 min

    [JYMA-015]Tall Wife With Big Tits And A Big Ass To Lure Men In Temptation. Super Horny Slutty And Masochistic Wife. Lewd Wife Teases With K-cup Tits For Horny Fun. Eri Takigawa

  • eri takikawa misato arisawa censoredcreampiebig titsJYMAtsukuzuku onna wa tsurai yobuddha dgroupJYMA-015JYMA015jyma00015
    • 2021-11-11
    118 min

    [JURA-044]First Time Shots Dear Wife, Once Again. Asako Kotoriyu

  • asako kotori censoredcreampiemarried womanJURAcenter villagesouthern earthjurakuJURA-044JURA044h-086jura00044
    • 2021-11-30
    50 min

    C0930 ki211130 Masayo Nagano 42years old

  • amateur uncensoredc0930
    • 2021-12-03
    56 min

    FC2PPV 2484058 [No] First Shot ♥ 20-Year-Old Short Hair, Shy Ubu Girl Made Her Av Debut ♡ I Put A Lot Of Adult Radical Play Into An Immature Sensitive Body WW

  • amateur uncensoredfc2
    • 2021-12-11
    150 min

    [CHRV-146]A Maso Big Titty Migrant Worker! She"s Going To Pay Back Her Big Brother"s Debts With Her Emotionally Big Titties! This Little Sister Has Big Tits Worth More Than Just One Look! 113cm J-Cup Titties Ricchan

  • censoredcreampiebig titsCHRVcherries reboCHRV-146CHRV146chrv00146
    • 2021-12-17
    92 min

    467SHINKI-070 "Depaga" [Train Molester] [Home Voyeur] [Sleep Fuck] Black Tight Knit Pink P (Of Yuki)

  • amateur censoredcreampieamateurshinkishinki-070shinki070467shinki-070
    • 2021-12-24
    73 min

    FC2PPV 2541309 [Personal Shooting] ★ The Best Muse At The End Of This Year That I Arrived At ~ Kimi Wa 1000 ★ I Will Show You All Of The Existence! !! Arisa (22 Years Old)

  • amateur uncensoredfc2
    • 2022-01-10
    52 min

    ZOCT-047 Horiuchi-san (Mikako Horiuchi)

  • amateur censoredcreampieamateurzoctzoct-047zoct047zoct-047
    • 2022-01-15
    123 min

    [ZOCM-020]Susceptible Married Woman Is So Horny She"s Quivering With Excitement, She Engages In Adultery And Sex All Day Long At A City Hotel While She"s Ovulating. Full Story. Married For 4 Years, Nerima Ward Resident, Aika Natsume (Alias),

  • aika natsume censoredcreampiesingle workZOCMzokuzoku musume mousouzokutodozokuzoku musumeZOCM-020ZOCM020zocm00020
    • 2022-01-15
    129 min

    [KTKL-102]This Beautiful Girl With A Hot, Shapely Crotch Was Really A Transsexual - Misato, 3 Works Recorded

  • censoredamateurbukkakeKTKLkichikkusu mousou zokuroriKTKL-102KTKL102ktkl00102
    • 2022-01-21
    137 min

    [ROE-040]Visiting My Wife"s Mom Three Years After Her Husband Died--All Reason Melted Away In The Heat Of The Summer Days I Spent Fucking Momoko. I"ll Never Forget Our Four Days And Three Nights Of Hot, Creampie Sex. Momoko Ishiki

  • momoko isshiki censoredcreampiebig titsROEmadonnaunicorn fukudamonroeROE-040ROE040roe00040
    • 2022-02-09
    87 min

    570DAVC-002 [Individual Shooting] H Cup Bank Clerk Leona (Tomiyasu Leona)

  • amateur censoredbig titsamateurdavcdavc-002davc002570davc-002
    • 2022-02-18
    209 min

    [MDTE-025]Raw Creampie In Sexy, Cute College Girl I Met On An Amazing App 07

  • censoredcreampieblowjobMDTEuchu kikakutetMDTE-025MDTE025mdte00025
    • 2022-02-19
    136 min

    [BEFG-007]Undercover Investigator Corrupted - PERSONA - Episode 2 - Her Honed Flesh Gradually Tainted By Pleasure From Fiends Who Savor It Mitsuki Nagisa

  • scooping censoredsingle workBEFGbabyentertainmentkikubongolden babeBEFG-007BEFG007befg00007
    • 2022-02-23
    73 min

    300MAAN-750 [Big Penis Limited Chi ● Kosomurier And Licking Dharma Girls] Every Time Before Sex, The Usual Chi ● Ko Measurement Time! I’m Very Excited About The Unexpected Big Dick Even Though I Measure It! !! As It Is Instinct, Show Off The Div

  • amateur censoredcreampieamateurmaanmaan-750maan750300maan-750
    • 2022-03-18
    180 min

    [SSIS-356]This Incredible Service Full Of Amazing Erotic Technology Can Make A Virgin Into A Sex Addict In A Month! Mei Washio New Cohabitation Document.

  • mei washio censoredbig titsSSISs one number one styletake ds1 no 1 styleSSIS-356SSIS356ssis00356



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored