high 209




FC2KBIFSDSSSPRDCAWDSQTESHKDDASDGVHNGODAVSAONEZMVSDAWDHMNRBDBBANSSNIPREDSDABNNPJ

2020-10-16
118 min

[MXGS-1154]A Natural Airhead With F-Cup Titties An Innocent And Pure Real-Life College Girl Her Adult Video Debut Miharu Tachibana

  • miharu tachibana censoredbig titsbeautiful girlMXGSmaxingikei keihaMXGS-1154MXGS1154h-068mxgs01154
    • 2020-10-19
    43 min

    305TRUMG-130 Shouko

  • amateur censoredamateurdramatrumgtrumg-130trumg130305trumg-130
    • 2020-10-19
    65 min

    328HMDN-304 Kanna

  • amateur censoreduniformschoolgirlhmdnhmdn-304hmdn304328hmdn-304
    • 2020-10-23
    127 min

    [BFD-003]Yeah, Definitely, Today, I'll Tell Him I Like Him. Karen Otoha

  • karen otoha censoredschoolgirlsingle workBFDdream ticketBFD-003BFD00324bfd00003
    • 2020-10-28
    41 min

    355OPCYN-113 Aina 2

  • amateur censoredcreampiemarried womanopcynopcyn-113opcyn113355opcyn-113
    • 2020-10-30
    58 min

    SIRO-4241 [First shot] [Pure white beauty body] [Dream is to become a voice actor] Around the age when you are interested in naughty things. The fluffy voice actor’s egg can not hide the surprise in the big cock size for the first time in my lif

  • amateur censoredamateursirosiro-4241siro4241siro-4241
    • 2020-10-31
    120 min

    [MIAA-341]I Hate That Middle-Aged Teacher, But When He Kisses Me With His Super Thick And Drooling Tongue, I Just Get So Excited... I Could No Longer Resist, As His Sweat, His Saliva, And His Drool Slid Down My Throat, As We Exchanged Bodily Fluids,

  • mitsuha higuchi censoredschoolgirlsingle workMIAAmoodyzgoemonminna no kikatanMIAA-341MIAA341miaa00341
    • 2020-11-07
    58 min

    H0930 ki201108 Ayumi Hinamori 31years old

  • amateur uncensoredh0930
    • 2020-11-26
    119 min

    [GS-364]This Rejuvenating Massage Parlor That Provides Deep And Rich Nipple-Licking Service Is Super Popular In Ikebukuro Right Now.

  • censoredGSsosoru x garconspada ikebukuroGS-364GS3641gs00364
    • 2020-11-28
    102 min

    390JAC-066 [Kamijiri 98cm GAL x 4 vaginal cum shot] In memory of Maradona, the child of God, Kamijiri GAL will be delivered in a hurry! Bomb butt 98 cm! GAL that is just right for God’s ass! Sprinkle the tide of God and climax! GAL who runs thro

  • cmgal censoredcreampiesquirtingjacjac-066jac066390jac-066
    • 2020-12-07
    101 min

    FC2PPV 1592972 [Student / Amateur individual shooting] Active JD with a cute smile and private Gonzo “I’m sorry ~~~ !!” I will expose the intensely dangerous image that I made it with a piston that does not quit even with teary eyes

  • amateur uncensoredfc2
    • 2020-12-08
    60 min

    Caribbeancom 120820-001 She reveals her true identity in bed Riina Okamoto

  • riina okamoto uncensoredcreampiehandjobcaribbeancom
    • 2020-12-08
    140 min

    [KIRE-014]Rinka Tahara (35 Years Old Occupation: Married Woman) They Made Me Pose As A J* Model...

  • rinka tahara censoredbig titsuniformKIREsod createafro takahashiKIRE-014KIRE0141kire00014
    • 2020-12-11
    155 min

    [YMDD-215]I Got My Hands On A Lucky Creampie Ticket, And Now I'm Going To See My Favorite Girl Rika Tsubaki

  • tsubaki rika censoredcreampiebig titsYMDDmomotaro eizotommy boywakamomoYMDD-215YMDD215ymdd00215
    • 2020-12-11
    42 min

    359TYVM-112 Erika

  • amateur censoredcreampiemarried womantyvmtyvm-112tyvm112359tyvm-112
    • 2020-12-18
    120 min

    [AQSH-062]"I'm So Sorry. It Was For Your Sake..." Hot Booty Wife Offers Up Her Body To Pay Off Her Husband's Bad Debt Renka Yamamoto

  • yamamoto renka censoredcreampiemature womanAQSHaquamall herowhite moleaquamallAQSH-062AQSH062aqsh00062
    • 2021-01-20
    130 min

    [GVH-181]I'm Your Sex Pet... You Can Order Me To Do Whatever You Want, And I'll Obey... Awakening As A Sub Urara Kanon

  • hanaoto urara censoredbdsmsingle workGVHglory questGVH-181GVH18113gvh00181
    • 2021-02-05
    97 min

    415LAS-035 Wannyan

  • amateur censoredcreampiesquirtinglaslas-035las035415las-035
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    123 min

    [AOI-005]Street Queen AV Debut!! The Queen Of The Street Who's Always Turning Heads Joins The World Of AV! Riria Hyodo

  • 3rd generation marie marie reiko kagami censoredAOIprestigecharlie nakatatokyo blueAOI-005AOI005104aoi00005
    • 2021-02-13
    76 min

    200GANA-2435 Seriously Nampa, first shot. 1597 Succeeded in picking up a female college student with a plump body who is worried about big ass! Take me to the hotel to help with body makeup and start touching on the training equipment ♪ Good quality

  • amateur censoredbig titsamateurganagana-2435gana2435200gana-2435
    • 2021-02-18
    41 min

    FC2PPV 1690754 [W brush grated GET] Poke-nma-i & Pika-yu! It feels so good at the first insertion that I can not stand it and inadvertently shoots vaginal cum shot! ？？ Double Virgin-kun Cosplay Creampie Graduation! * Complete appearance

  • amateur uncensoredfc2
    • 2021-02-21
    116 min

    [HND-948]She's Lifting Her Creampie Ban For The Very First Time You Get To Exclusively Rent A Former Idol For 2 Days And 1 Night And Have Infinite Creampies Until Your Time Runs Out A Hot Spring Resort Vacation Special Featuring 10 Ejaculations F

  • minano sora censoredcreampieblowjobHNDhon nakatiger kosakaiHND-948HND948hnd00948
    • 2021-02-25
    195 min

    [PIYO-106]These Y********ls Will Give You Hot Nookie Kisses, Drool, And Full-On Face Licking! "I Want To Be Lured To Temptation By A S********l Who Wants To Practically Eat My Face!"

  • censoredschoolgirlbeautiful girlPIYOhyokopiero dabicchiPIYO-106PIYO1061piyo00106
    • 2021-02-25
    124 min

    [JRZE-031]First Time Filming My Affair: Yu Nii

  • yu arai censoredcreampiemature womanJRZEcenter villagekotaro misatojurakuJRZE-031JRZE031h-086jrze00031
    • 2021-02-26
    32 min

    [CLO-130]The Downfall Of Sucking On Masochistic Tits Kanna Shinozaki

  • kina shinozaki censoredhandjobCLOchobitchchovicCLO-130CLO130h-1435clo00130
    • 2021-03-11
    43 min

    [orec-713]なつき 2

  • amateur censoredcreampieamateurorecorec-713orec713orec-713
    • 2021-03-26
    130 min

    [GNAX-049]Sex Servant After School I Am A Sex Toy For My Classmates Noa Eikawa

  • sakaegawa noa censoredcreampieuniformGNAXnagirakazumaGNAX-049GNAX049h-1345gnax00049
    • 2021-03-26
    239 min

    [OKAX-720]A Live Broadcast During Undercover Negotiations To Fuck A Mature Woman After They Put Out A Want Ad 4 Hours

  • censoredamateurmature womanOKAXk m producedick mandokuokazuOKAX-720OKAX72084okax00720
    • 2021-03-27
    120 min

    [MACB-023]Hカップ癒し系ロリ巨乳妻 敏感ロケット乳を吸ったり揉んだりされ浮気交尾でガチイキしちゃった… 小梅えな

  • ena koume censoredMACBsharkmedia cubeMACB-023MACB023h-687macb00023
    • 2021-04-14
    16 min

    FC2PPV 1748578 [Personal shooting] Shion 20 years old Short SEX remastered version [Limited time offer]

  • amateur uncensoredfc2
    • 2021-05-07
    143 min

    [IPX-652]Cheating On A Work Trip: Hot Female Employee Made To Cum By Her Hung Boss Miu Shiromine

  • shiramine miu censoredblowjobsingle workIPXidea pocketbungo maedadishIPX-652IPX652ipx00652
    • 2021-05-20
    93 min

    [OKS-112]Suzu Takayama Wet And Shiny And Tight A Goddess In A Competitive Swimsuit Enjoy A Cute Girl In A School Swimsuit To Your Heart's Content! Watch Her Change In Peeping Videos, And Check Out Her Tiny Titties, Big Tits, And Shaved Pussy Fun,

  • takayama tin censoredschoolgirlbeautiful girlOKSdaddy s private photosgoddess in a school swimsuitOKS-112OKS1121oks00112
    • 2021-05-21
    55 min

    230OREC-775 Hana

  • amateur censoredcreampiebig titsorecorec-775orec775230orec-775
    • 2021-06-03
    485 min

    [AKDL-116]9 Fucks Involving Barely Legal Babes Who Love Older Men And Will Get Their Slut On While Smiling And Getting Them Erect Even If Their Wives Are Nearby

  • sana moribo yoko kokoro censoredbig titsbeautiful girlAKDLaquinoriaquinoriaknrAKDL-116AKDL1161akdl00116
    • 2021-06-12
    81 min

    300MAAN-663 [Purupuru ♪ Kamijiri x Abnormal Sensitivity x Bouncing Delicate BODY] Kamijiri with erotic recoil! Slow tempo blowjob that slowly and carefully licks! Cho sensitive constitution that makes you feel swaying! Imadoki’s emo beautiful gi

  • amateur censoredcreampieamateurmaanmaan-663maan663300maan-663
    • 2021-06-15
    47 min

    481SACZ-040 Sachiyo 6

  • amateur censoredamateurmature womansaczsacz-040sacz040481sacz-040
    • 2021-06-20
    54 min

    SIRO-4494 AV application on the net → AV experience shooting 1567 [First shot] [Face level S class] [Slender body that shines] I am curious about cute faces and naughty things. Take off the clothes of a fashionable active female college student, a ho

  • amateur censoredsquirtingamateursirosiro-4494siro4494siro-4494
    • 2021-06-23
    110 min

    428SUKE-076 [Transcendence squeezing tech → squeezing] MADOKA-chan ★ de M must-see! Queen of beautiful big breasts soft ass advent! Become a gold ball bread bread! !! The second round with a policewoman costume from a crisp vaginal cum shot! ？？ Being

  • madoka censoredcreampiebig titssukesuke-076suke076428suke-076
    • 2021-06-25
    150 min

    [WAAA-075]Even After Cumming And Cleaning The Cum Off, I'll Keep Giving You A Sucking!! Tsubomi

  • bud censoredcreampieblowjobWAAAwanz factorywanzWAAA-075WAAA075waaa00075
    • 2021-07-09
    120 min

    [IPX-684]Portable Nurse Call Button Allows Blow Jobs 24 Hours a Day! Nympho Nurses who Love Immediate Fellatio Iyona Fuji

  • iyo fujii censoredblowjobbeautiful girlIPXidea pocketsuisei akaidishIPX-684IPX684ipx00684
    • 2021-08-06
    118 min

    [IPX-701]"I Was Fucked Hard..." One After The Other... Baton- Fucked Race Queen Iyona Fujii

  • iyo fujii censoredcosplaysingle workIPXidea pocketzack araitissueIPX-701IPX701ipx00701
    • 2021-08-28
    47 min

    H0930 ori1610 Sae Kubodera 35years old

  • amateur uncensoredh0930
    • 2021-09-04
    32 min

    210AKO-438 Runa

  • amateur censoredcreampieamateurakoako-438ako438210ako-438
    • 2021-09-17
    119 min

    [MEYD-705]NTR At My Part-Time Job I Was Listening To A Horny Married Woman Complain About Her Life, And Then She Started Having Creampie Sex With Me, Every Single Day Ichika Seta

  • kazuhana seta censoredcreampiebig titsMEYDtameike goroinugami ryouMEYD-705MEYD705meyd00705
    • 2021-09-25
    241 min

    [SGSR-286]Town Amateur College Girl Channel, Super Cute College Gal Looking For Work Yells "Don"t Look!" But Take Me To A Hotel! Being Real Is Important In Both Job Hunting And Fucking! 4 Hours 14 Women

  • censoredcreampieamateurSGSRbigmorkalshin sen kumiSGSR-286SGSR28657sgsr00286
    • 2021-09-25
    81 min

    521MGFX-024 Beautiful Girl With Long Nipples In The Complex

  • amateur censoredamateurbeautiful girlmgfxmgfx-024mgfx024521mgfx-024
    • 2021-10-01
    107 min

    [SHKD-965]That Night Where I Just Had To Creampie That Girl - Ichika Matsumoto

  • ichika matsumoto censoredsingle workSHKDattackersakawa yuushi yoru akuSHKD-965SHKD965shkd00965
    • 2021-10-02
    243 min

    [MMB-388]Amazing Nerdy Beautiful Y********l In Uniform 10 Girls, I Usually Don"t Read, But When I Went To The Library To K**l Time, I Ended Up Fucking An Erotic Nerdy Beautiful Y********l In Uniform Who Loves Books Raw For A Creampie

  • mari takasugi arisaka miyuki censoredcreampieuniformMMBmomotarou eizou shuppanishikiribashi hakasemomotaro bestMMB-388MMB388mmb00388
    • 2021-10-22
    121 min

    [HMN-070]Looking Like Someone Else At First. This AV Actress Looks Kind Of Like My Girlfriend... An All-day Date Turns To Jealousy And A Whirlwind Of Overconfidence That Ends In A Serious Creampie Load. Aoi Kururgi

  • aoi kururugi censoredcreampiebeautiful girlHMNhonnakatanaka baconHMN-070HMN070hmn00070
    • 2021-10-28
    66 min

    336KNB-178 [Help] After My Husband ● Po Is Too Big To Enter! But I Want To Have Sex! Fit Chi ● In Search Of Po, Sansenri… At Wako City, Saitama Prefecture Wako City Station (Erina Noto)

  • amateur censoredbig titsmarried womanknbknb-178knb178336knb-178
    • 2021-10-30
    240 min

    [YMDD-251]I"ve Never Seen Titties Like These! A Dream-Cum-True J-Cup Titty Newly Grown-Up Babe!! Hana Himesaki Best Hits Collection

  • himesaki hana censoredcreampiebig titsYMDDmomotaro video publishingdr ishikiri bridgeyoung peachYMDD-251YMDD251ymdd00251
    • 2021-11-03
    94 min

    300MAAN-715 [Erotic M Do Metamorphosis Nursery Teacher] A Super Strong Man With An Anecdote That The Nursery School Was Dismissed By Forbidden Erotic Acts Appeared! !! While Shaking The Huge Breasts Of The H Cup, Devouring Sexual Desire, Ascending Ma

  • amateur censoredcreampiebig titsmaanmaan-715maan715300maan-715
    • 2021-11-06
    133 min

    [CEMD-078]Anal Temptation Sex Wan Horikita - We Got Our Fill Of Sex With A Girl When Our C*cks Got Excited For Anal Fucking! -

  • horikita wan censoredanalmature womanCEMDserebu no tomoCEMD-078CEMD078cemd00078
    • 2021-11-20
    130 min

    [MGMQ-084]M-sexual Clinic With Genius S-Lascivious Nurse Who Treats The Anus Of Every Man In The Hospital Mao Hamasaki

  • hamazaki mao censoredanalslutMGMQmegamithe beautiful goddess queenMGMQ-084MGMQ084mgmq00084
    • 2021-11-20
    53 min

    355OPCYN-205 Urara 2 (Urara Kanon)

  • amateur censoredcreampieamateuropcynopcyn-205opcyn205355opcyn-205



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored