high visio jav censored javcensored big butt




FC2IPXDASDATIDSANMEYDAUKSSSNISPRDDASDAVSASSISMARACESDCAWDCJODAUKGCHRVVEMABLKEBOD

2023-10-26
172 min

HAWA-304 Now, I Would Like To Introduce You To The Most Erotic Sex Friend Wife. Beautiful Sex Friend Wife Hitomi (28 Years Old) Who Loves Cock And Swallows And Cums In Anyone"s Sperm With A Smile

  • censoredcreampieHAWAcosmos videonagase hawaiicosmospictures soft on demandHAWA-304HAWA3041hawa00304
    • 2023-10-26
    181 min

    MTES-110 Let Me Do It, Mom. The Naughtiness Of A Mature Woman.

  • censoredMTESclassic pornmasterpiece pornMTES-110MTES110h-1300mtes00110
    • 2023-10-23
    50 min

    NHDTB-85904 Raw Molester Group 7 Big Ass Neat Married Woman

  • censoredcreampieNHDTBnatural highsakurai vanillanatufileNHDTB-85904NHDTB859041nhdtb85904
    • 2023-10-21
    240 min

    UMSO-523 An Overwhelming Presence That Is Too Assertive! ! 12 Beautiful Women With Rocket Boobs

  • hebei haruna hikari sena censoredcreampieUMSOkm produceumanamiUMSO-523UMSO523umso00523
    • 2023-10-21
    103 min

    ANX-157 Shin/Happy Slave Woman #Rikugo #Yinkya #Oshikatsu #Indecent Yukari Nonoka

  • is it yukari s censoredsquirtingsingle workANXhypnosis lab mousouhosthypnosisANX-157ANX157anx00157
    • 2023-10-21
    171 min

    KATU-120 I"ll Send You A Naughty Caregiver With Big Nipples And A Super Plump Chubby Doll.

  • censoredslutKATUkatsuo product delusion groupmaglowKATU-120KATU120katu00120
    • 2023-10-21
    65 min

    CSPL-022 [4K] 4K Revolution The Costume Is Cute, But...I Can"t Stop. Erika Ozaki

  • ozaki erika censoredcreampieuniformCSPLcrystal picturecosdeluxe plusCSPL-022CSPL022cspl00022
    • 2023-10-21
    120 min

    NASH-972 I Can"t Wait Until My Husband Comes Home! Frustrated Aunt In Her 50s

  • censoredNASHpinknadeshikoNASH-972NASH972nash00972
    • 2023-10-21
    140 min

    MADM-173 [4K] Big Tits, Big Butt, Chubby Married Woman Instructor. Bold Seduction In Highly Revealing Perverted Wear. Forbidden Creampie Affair In A Dream-like Development. Kaho Tamaki.

  • tamaki natsuho censoredcreampieslutMADMcrystal picturemadam maniacMADM-173MADM173madm00173
    • 2023-10-20
    114 min

    AMBI-180 Before Graduation, I Stayed With My Teacher Until The Morning... Monaka Sengoku

  • sengoku monaka censoredcreampiebeautiful girlAMBIplanet plusrecobaambibarentzAMBI-180AMBI180h-237ambi00180
    • 2023-10-20
    123 min

    NACR-717 My Girlfriend Is Hoshino Natsuki

  • hoshino natsuki censoredcreampiebeautiful girlNACRplanet plusrecobashichidomeNACR-717NACR717h-237nacr00717
    • 2023-10-20
    160 min

    JUQ-424 Dengeki Transfer Madonna Exclusive Miki Akai With A Divine Big Butt In The Heat Of Heat 3 Intense Creampies Full Of Bewitching Adult Sex Appeal

  • akai miki censoredsingle workJUQmadonnamamezawa mametaroJUQ-424JUQ424juq00424
    • 2023-10-20
    150 min

    CJOD-400 Super Teasing Temptation With 1mm Cloth! Pan! Pan! Change Gears After Rubbing The Big Ass Of The Man Meat Until The Dick Becomes Erect! Mizuki Yayoi, A Slutty Esthetician Who Depletes Sperm With Non-stop Continuous Creampie In A Super Fast P

  • mizuki yayoi censoredcreampieslutCJODslut havenhiroharu osakiCJOD-400CJOD400cjod00400
    • 2023-10-20
    126 min

    ORECS-056 Astonishing Repeat Rate 100 (^^) Miss Menesu, Who Has Been Waiting For 3 Months For Reservations. Obscene And Extremely Erotic Back Option. No Time Limit//Raw Insertion Creampie Massage Miss Nakagawa/22 Years Old/T151B97(H)W60H89 Miss Shira

  • censoredcreampieORECSmy amateur z second impactORECS-056ORECS056h-1732orecs00056
    • 2023-10-20
    241 min

    NACX-129 12 Chubby Beautiful Mature Women BEST VOL.04

  • rin okae natsuko kayama censoredNACXplanet plusshichidomeNACX-129NACX129h-237nacx00129
    • 2023-10-19
    240 min

    AARM-200 I Want Akari Niimura To Do All The Erotic Things! !

  • akari shinmura censoredslutsingle workAARMaroma planningaromaAARM-200AARM200aarm00200
    • 2023-10-16
    52 min

    NHDTB-84602 A Busty Aunt, A Fair-skinned Plump Wife Who Hugs Her Nephew, Who She Thought Was A Child, Licks His Ear And Pees In Heat

  • censoredNHDTBnatural highneapolitannatufileNHDTB-84602NHDTB846021nhdtb84602
    • 2023-10-16
    47 min

    NHDTB-84603 A Big-breasted Aunt Who Hugs Her Nephew, Who She Thought Was A Child, Licks His Ear And Makes Him Pee In Heat. A Gentle Glamorous Wife.

  • censoredNHDTBnatural highneapolitannatufileNHDTB-84603NHDTB846031nhdtb84603
    • 2023-10-14
    130 min

    KHIP-017 When I Moved To A New House, I Became My Next-door Neighbor, And I Begged A Lot Of Times To Beg A Big-assed Lady Who Was Weak Against Pressure, And When She Finally Let Me Have Sex With Her, The Single Office Lady"s Sexual Desire Was So

  • mizuki yayoi censoredcreampiesingle workKHIPprincess kaguya pt delusional familynortonkaguya hipKHIP-017KHIP017khip00017
    • 2023-10-14
    129 min

    MYBA-063 Married Woman"s Petal Turning Ayana Rina

  • rina ayana akari nanara censoredcreampiesingle workMYBAmarried women s relief society emanuelyellow leopardMYBA-063MYBA063myba00063
    • 2023-10-14
    128 min

    MRHP-027 Be Careful Of Delivery Problems! Yui Hatano, An Unscrupulous Transporter, Couldn"t Stand The Big Ass Of A Married Woman That Could Be Seen Even Through Her Clothes, So She Inserted Herself And Creampied Him Every Day.

  • yui hatano censoredcreampiesingle workMRHPmrs emmanuelnortonmrs assMRHP-027MRHP027mrhp00027
    • 2023-10-14
    109 min

    TIKB-170 [Be Careful Not To Jerk Off Too Much] Choroman Gal"s Paco Paco Friend Erika-tan Erika Ozaki

  • ozaki erika censoredsingle workTIKBchikikikikama delusion groupTIKB-170TIKB170tikb00170
    • 2023-10-14
    131 min

    TIKB-173 Drunk Slug Gal! Cum Swallowing Perolist Manami Oura

  • manami oura censoredcreampieslutTIKBchikikikikama delusion groupTIKB-173TIKB173tikb00173
    • 2023-10-14
    171 min

    MMKZ-135 The Big Butt Of A Slender, Short-haired Beautiful Girl Is So Erotic Yuuki Hiiragi

  • hiiragi yuuki censoredsingle workMMKZmarrionkojiro miyamotoirisMMKZ-135MMKZ135mmkz00135
    • 2023-10-14
    112 min

    TIKB-172 [Pakopaco Video] This Lovey-dovey Couple! Too Erotic To Do Www Hamasaki Mao

  • hamazaki mao censoredcreampiesingle workTIKBchikikikikama delusion groupTIKB-172TIKB172tikb00172
    • 2023-10-13
    200 min

    HJMO-620 Big Butt Married Women Only! Ass Meat Jiggling! 1cm Air Chair Patience Game Tournament! If You Can Hold Back With The Tip Of A Big Dick, Which Is Much Bigger Than Your Husband"s, In Your Pussy For A Long Time, You"ll Get 1 Million Ye

  • censoredcreampieHJMOfirst planjohann yuanHJMO-620HJMO620hjmo00620
    • 2023-10-13
    120 min

    MIAA-993 Cowgirl Position With A Big Ass And A Big Ass. Jun Suehiro Uses An Aphrodisiac To Make An Automatic Creampie Masturbator For His Remarried Partner"s Stepchild J●.

  • suehiro jun censoredcreampiesquirtingMIAAmoody sdragon nishikawaeveryone s kikatanMIAA-993MIAA993miaa00993
    • 2023-10-13
    150 min

    JUFE-521 The Hidden Obscene Sexuality Of An Older Sister Overflowing With Pheromones! Ichika Seta Shows Off Her Smelly Ass Hole And Makes Me Lick It And Seduces Her With Her Plump Big Butt

  • kazuhana seta censoredanalslutJUFEfitchnabepreciousJUFE-521JUFE521jufe00521
    • 2023-10-13
    180 min

    EBWH-026 見た目は清楚、中身はどスケベ 身長170cm B90cm（F） H96cm 8頭身お嬢様 AVデビュー 葉澄かえで

  • hasumi kaede censoredsingle workEBWHe bodymamezawa mametaroEBWH-026EBWH026ebwh00026
    • 2023-10-13
    150 min

    EBWH-023 She"s A Fast-talking Female Otaku Who Makes Her Life Worth Living As A Male Friend, But... Megumi"s Plump, H-cup, Lewd Body, Female Climax, AV Debut, Nano Yazawa

  • yazawa nano censoredsingle workEBWHe bodykyouseiEBWH-023EBWH023ebwh00023
    • 2023-10-13
    170 min

    JUFE-526 Devilishly Slow Ejaculation Control. A Sensual Slut Who Carefully Plays With Her Cock. Hibiki Otsuki.

  • otsuki sound censoredcreampieslutJUFEfitchyumeno aidaJUFE-526JUFE526jufe00526
    • 2023-10-12
    286 min

    FTKD-009 At The Underwear Manufacturer I Worked For, There Were Only Female Employees With Too Big Breasts, And I Was The Only Male Employee! It"s Normal To Wear Underwear In The Office! ？ When He Gets Erect And Is In A State Of Shock, Big Boobs

  • censoredcreampieFTKDfaleno tubeFTKD-009FTKD0091ftkd00009
    • 2023-10-12
    121 min

    UMD-889 I"ve Been In The Hospital For So Long That I End Up Getting An Erection Every Day Because Of The Unsuspecting New Nurse"s Tight Panty Butt 5

  • tachibana mary saitou amiri censoredslutnurseUMDleodragon nishikawaUMD-889UMD889125umd00889
    • 2023-10-12
    138 min

    MIST-416 YAPPA! Tsubaki Kato, The Eroticism That A High-career Actress Wants To Show The Most Right Now, The Masochistic Sex With Her Face Fully Open, And The Intense Hard Sex

  • kato camellia kaoru natsuki censoredcreampieslutMISTmr michirusteven sorterbergMIST-416MIST4161mist00416
    • 2023-10-12
    155 min

    MIST-414 Direct Hit On A Dangerous Day! ! Soap 49 For Making Babies Hotaru Nogi

  • nogi firefly censoredcreampiesingle workMISTmr michirusaitaMIST-414MIST4141mist00414
    • 2023-10-08
    202 min

    SUN-099 Super Big Butt Exposed - Sensitive Yoshiko Gets Wet From Being Spanked, And I Play With Her From Behind Many Times On A Date Maria (29)

  • censoredSUNsuntanaka baconSUN-099SUN0991sun00099
    • 2023-10-07
    154 min

    MDBK-303 A Trio Of Beautiful Girls Who Provoke Me With Extreme Thongs, Butt Torture Harem Sex Anywhere

  • kyono uta scooping censoredcreampieschoolgirlMDBKbazookacamelMDBK-303MDBK303mdbk00303
    • 2023-10-07
    133 min

    MKMP-529 Haruka Miokawa, An Entertainment Inn That Squeezes Out The Sperm Of Masochist Men Saved In The Village

  • miogawa haruka censoredslutsingle workMKMPkm producegoemonmillionMKMP-529MKMP529mkmp00529
    • 2023-10-07
    132 min

    TPIN-063 My Room Has Become A 100 All-you-can-eat Room Where I Can"t Escape The Temptation Of The Double Big Ass. Nonoka Yukari Rin Amemiya

  • is it yukari s jun amemiya censoredcreampieTPINtsubakihoinTPIN-063TPIN063tpin00063
    • 2023-10-06
    120 min

    NDRA-107 I"m Also Having Sex With Her Mother Without Telling Her... Reika Ichiba

  • ichiba reika censoredsingle workNDRAjet videogroupNDRA-107NDRA107ndra00107
    • 2023-10-05
    242 min

    NACX-128 I Can"t Stand The Horniness Anymore! Climax Masturbation Of 24 Beautiful Mature Women VOL.03

  • nanako miyamura minori junoka censoredNACXplanet plusshichidomeNACX-128NACX128h-237nacx00128
    • 2023-10-05
    121 min

    CLOT-023 Pantyhose Crazy Father-in-law Erika Ozaki

  • ozaki erika censoredsingle workCLOTplanet plusgentlemancloseCLOT-023CLOT023h-237clot00023
    • 2023-10-05
    118 min

    NACR-712 Monami Takarada, The Boss"s Wife Who Seduces Me By Showing Off Her Big Breasts

  • takarada monami censoredcreampieslutNACRplanet plushimrockshichidomeNACR-712NACR712h-237nacr00712
    • 2023-10-05
    240 min

    ZMAR-097 Fully! Haruna Hana 3

  • haruna hana censoredsingle workZMARplanet plusmaruttoZMAR-097ZMAR097h-237zmar00097
    • 2023-09-30
    161 min

    LULU-243 While My Husband Was On A Business Trip, I Couldn"t Stand My Big-assed Aunt"s Cleaning Ass While We Were Alone At Home, So I Immediately Shook Her Ass With A Big Cock Piston, And She Convulsed And Squeezed My Balls Repeatedly. Akari

  • akari shinmura censoredcreampiesingle workLULUlunaticsluminaxLULU-243LULU243lulu00243
    • 2023-09-30
    160 min

    LULU-245 The Day Before The Wedding, My Childhood Friend (ex-girlfriend) With A Big Butt And Big Ass Came To Me And Was Jealous And Held Me In The Cowgirl Position While Shaking My Ass And Wouldn"t Let Me Go, So I Was Made To Plunder And Cum Unti

  • hiiragi yuuki censoredcreampiesingle workLULUlunaticsvragmanLULU-245LULU245lulu00245
    • 2023-09-30
    134 min

    DLPN-030 ``I Get Compliments On My Butt A Lot."" She Has An Elegant Face And A Fair-skinned, Plump, Big Butt. Jun (31), A Naturally Loving Wife Who Has A Super Sensitive Constitution And Cums Over And Over Again.

  • censoredamateurDLPNdolphin emmanuelDLPN-030DLPN030dlpn00030
    • 2023-09-30
    141 min

    BAB-105 BREAKING NTR Luna Shimotsuki

  • shimotsuki runa censoredcreampiesingle workBABbabylon mousouBAB-105BAB105bab00105
    • 2023-09-30
    160 min

    LULU-247 I Made My Girlfriend"s Younger Sister, Who Is Strong And Boyish, Drink An Aphrodisiac And Continue To Tease Her By Inserting 1cm Of The Tip, And Made Her Ejaculate With A Piston That Hits The Back Of Her Vagina, Making Her Into A Sexual

  • monami bell censoredcreampieschoolgirlLULUlunaticsnagases wingLULU-247LULU247lulu00247
    • 2023-09-29
    130 min

    JUFE-520 Only When My Girlfriend Comes Home...A Childhood Friend Azuma Amazuki Rubs Her Big Butt Without Wearing Panties And Squeezes Out My Sperm.

  • amatsuki azu censoredsingle workJUFEfitchkoenji goropreciousJUFE-520JUFE520jufe00520
    • 2023-09-29
    120 min

    WAAA-308 The Plump J-type Athlete"s Big Ass Is Irresistible... He Rubs His Dick Against Her Stuffy Bloomers As She Performs Squats To Strengthen Her Lower Body! Unable To Resist Each Other, They Thrust Up And Cum In Sweaty Piston Cowgirl Position

  • shirahama minami censoredcreampiesingle workWAAAones factorywanzWAAA-308WAAA308waaa00308
    • 2023-09-29
    150 min

    JUFE-517 Old Man"s Gonzo Documentary - Sweaty Sexual Intercourse With Rich And Sticky Body Fluids - Mai Arisu

  • arisu mai censoredcreampieschoolgirlJUFEfitchlamb chopJUFE-517JUFE517jufe00517
    • 2023-09-29
    180 min

    JUFE-519 Big-assed Female Teacher Straddles A Man And Devours The Essence With Continuous Ejaculation SEX Mina Kitano

  • mina kitano censoredcreampiesingle workJUFEfitchxxlpreciousJUFE-519JUFE519jufe00519
    • 2023-09-29
    154 min

    DVEH-015 Yuina Taki, A Tall And Beautiful Personal Trainer With A Voluptuous Big Butt Who Repeats The Temptation To Collapse Her Rationality In Search Of The Best Protein (sperm)

  • taki yuina censoredcreampiesingle workDVEHdeepspearl father jrdeep s 3rd storeDVEH-015DVEH015dveh00015
    • 2023-09-25
    55 min

    NHDTB-79008 Sensitive (shameful) Big Breasts Slut 2023 Estimated G Cup/Big Butt Landlady

  • censoredNHDTBnatural highkansukenatufileNHDTB-79008NHDTB790081nhdtb79008
    • 2023-09-24
    125 min

    JKW-027 Divine Breasts Impregnated And Fallen Breasts Wife Mating Katase Natsumi

  • katase natsumi censoredcreampiesingle workJKWjewelJKW-027JKW027h-848jkw00027



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored