high visio jav javcensored hours more mature woma




FC2IPXNNPJADNNGODAUKSMVSDMIDEONEZLULUDASDSPRDFSDSSHNDAWDPPPDSQTEHDKASHKDHMNHZGD

2020-12-24
120 min

[HBAD-568]My Fair-Skinned Wife - Healthy Bride Offers Herself To Her Husband's Bosses In His Place Mahoro Kamiki

  • mahoro kamiki censoredblowjobsingle workHBADhibinonamitaro umababeHBAD-568HBAD5681hbad00568
    • 2020-12-25
    242 min

    [MKMP-371]Iori Nanase Complete BEST 4 Hours

  • iori nanase censoredcreampiebig titsMKMPk m producemillionMKMP-371MKMP37184mkmp00371
    • 2021-01-01
    122 min

    [NACR-389]A Son's Wife - Aoi Kururuki

  • aoi kururugi censoredcreampiesingle workNACRplanet plusdirector onanakuruNACR-389NACR389h-237nacr00389
    • 2021-01-06
    39 min

    [srtd-190]つぐみ(18)

  • amateur censoredschoolgirlamateursrtdsrtd-190srtd190srtd-190
    • 2021-01-08
    181 min

    [PIYO-098]I Want To Live Off Your Womb - Ever Since I Was Young I Knew I Wanted To Be A Gynecologist. Now I Finally Have My Very First Patient, A Y********l Who's Everything I Hope She Would Be, And Now I Get To Explore Her Inside And Out.

  • censoredcreampieschoolgirlPIYOhyokopiero dagrey wolfPIYO-098PIYO0981piyo00098
    • 2021-01-10
    120 min

    [TTTV-003]Historical Porn: She Lost Her Husband In The War, Now She's Satisfying Her Father-In-Law's Urges And Breeding With Other Men Miki Sunohara

  • future sunohara censoredmature womansingle workTTTVglobal media annexkikujiro akabanetentativeTTTV-003TTTV003tttv00003
    • 2021-01-22
    51 min

    [oretd-841]MOMOTA

  • amateur censoredcreampieuniformoretdoretd-841oretd841oretd-841
    • 2021-01-24
    54 min

    FC2PPV 1658307 [Personal shooting] Sex with a perverted fifty aunt who can’t control her lust!

  • amateur uncensoredfc2
    • 2021-02-06
    44 min

    C0930 ki210207 Hitomi Aoshima 25years old

  • amateur uncensoredc0930
    • 2021-02-10
    43 min

    FC2PPV 1679611 [February limited sale] Hime-chan and above are unreasonable! Sorry for being too erotic. Immediately after being hit by a famous instrument, a large amount of vaginal cum shot is made to a pre-ketsu beauty man with fair skin! !! The f

  • amateur uncensoredfc2
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    119 min

    [GZAP-041]This Tiny Titty Beautiful Girl Was On The Way Home After Swim Team Practice, And She Was Sprinkled With Aphrodisiacs And Became Drenched With Lust, And Now She Was Getting Her Sensual Nipples Tweaked Until She Started Begging For Creampie S

  • censoredbeautiful girlGZAPprestigezapGZAP-041GZAP041118gzap00041
    • 2021-02-19
    105 min

    [VEMA-156]Lusty Nursery School Teacher Preys On Doting Dads Rei Aoki

  • rei aoki censoredcreampiemature womanVEMAvenusbingo tamatsukamegami venusVEMA-156VEMA156vema00156
    • 2021-02-19
    35 min

    S-Cute 829_hinako_01 SEX of a neat and clean girl who is obscene enough to take off / Hinako

  • hinako censoredamateurhinakohinako-01hinako01829-hinako-01
    • 2021-02-21
    61 min

    SIRO-4415 [First shot] [Neat OL pleasure fallen] [G milk shaking hard SEX] Healing beauty who squeaks her crotch and culminates many times. Big breasts increase the power of beauty every time it shakes .. Application amateur, first AV shooting 195

  • amateur censoredbig titssquirtingsirosiro-4415siro4415siro-4415
    • 2021-02-24
    128 min

    [BNST-026]Friends With Benefits Luna Holiday Fucking My Hot Fuck Buddy's Brains Out Runa Tsukino

  • tsukino luna censoredcreampiebeautiful girlBNSTteacher delusion groupkamagramBNST-026BNST026bnst00026
    • 2021-02-25
    165 min

    [SVDVD-844]Shame! The Male/Female Equal Opportunity Special Education Ward Starting This Year, Every Monday Will Be Declared An All-Nude Day 2021 New School Semester Edition

  • akane shiki yuki s censoredcreampiesquirtingSVDVDsadistic villageista girl and her shameSVDVD-844SVDVD8441svdvd00844
    • 2021-03-05
    87 min

    300MAAN-630 [H-cup god body healing nurse takes down NTR brush] At the request of her boyfriend, while taking off her skin to a man who does not like it, the small devil mode is activated! !! Munyumunyu milk pressure fucking explodes to play with de

  • amateur censoredcreampiebig titsmaanmaan-630maan630300maan-630
    • 2021-03-09
    481 min

    [MUCH-124]Hot Steamy Sex With Forty Something Year Old Vixens 10 Women 8 Hours 2 Video Set

  • shinobu igarashi hitomi kanno censoredcreampiebig titsMUCHmothermuchi mutchiMUCH-124MUCH124h-796much00124
    • 2021-03-11
    122 min

    [FSDSS-188]The Peeing Nurse Chief Is A Swallowing Slut Ayaka Tomoda

  • ayaka tomoda censoredsquirtingslutFSDSSfalenomusetafaleno starFSDSS-188FSDSS1881fsdss00188
    • 2021-03-11
    71 min

    H4610 ki210311 Airi Shinohara 24years old

  • amateur uncensoredh4610
    • 2021-03-13
    124 min

    [MOPT-004]The Greatest Maso Sex Club, Where Maso Men Can Get Their Cocks Teased To Within An Inch Of Ejaculation Through Pull Out Withdrawals Azusa Misaki

  • misaki azusa censoredanalslutMOPTm o paradisemo tightMOPT-004MOPT004mopt00004
    • 2021-03-14

    FC2PPV 1726550 Limited number [Uncensored] Big breasts J cup that child, fucking cum shot

  • amateur uncensoredfc2
    • 2021-03-27
    55 min

    HEYZO 2489 Exploring Every Corner Of A Girl With Big Beautiful Bazookas! – Rena Hiragi

  • rena hiragi uncensoredcreampiehandjobheyzo
    • 2021-04-02
    180 min

    [PRED-302]Wallowing In Shame, Sweat, And Body Fluids...Licking Instinct And Kissing Orgasms Kano Kashii

  • kashii hanano censoredcreampiesquirtingPREDpremiumcaptain eharaelegancePRED-302PRED302pred00302
    • 2021-05-01
    162 min

    [ATID-461]Insurance Agent Shameful Pooping 7 Minatsu Aikawa

  • mika aikawa censoredsingle workATIDattackersrokusaburo mishimain madATID-461ATID461atid00461
    • 2021-05-06
    42 min

    475SKCK-032 Kaname 6

  • amateur censoredanalamateurskckskck-032skck032475skck-032
    • 2021-05-17
    63 min

    SIRO-4524 [First shot] [Thick big butt] [M lady’s begging] A frustrated married manicurist with a lewd pheromone. Sexless hungry body, swinging down a big butt to unfaithful ○ Po, exposing the female face over and over again .. AV application on

  • amateur censoredmarried womanamateursirosiro-4524siro4524siro-4524
    • 2021-05-22
    240 min

    [OKAX-739]Negotiating With The Escort At The No-Insertion Sex Play Parlor Until She Let Me Fuck Her Raw 240 Minutes

  • censoredmature womanOKAXk m producedick mandokuokazuOKAX-739OKAX739okax00739
    • 2021-05-22
    241 min

    [OKAX-738]Filthy Massage Parlor Where Beautiful Older Women Shake Their Hips And Cum 240 Minutes

  • censoredamateurmature womanOKAXk m producedick mandokuokazuOKAX-738OKAX738okax00738
    • 2021-05-28
    56 min

    FC2PPV 1841342 * Monthly limited 2980⇒1980pt ★ First shot ☆ Rainy day married woman! A beautiful mom with a child gets a vaginal cum shot with another stick ♥ Sakura’s 23 years old ☆ Electric Maiki ♥ Intense cancer thrusting bicubic faint in ago

  • amateur uncensoredfc2
    • 2021-06-04
    122 min

    [UMD-781]A Fresh Face Office Lady Who Was Targeted During The Company Trip 2

  • himari kinoshita himari hanazawa nana maeno censoredUMDleodragon nishikawaUMD-781UMD781125umd00781
    • 2021-06-04
    60 min

    Caribbeancom 060421-001 Like The Butterflies: Two Wheels Soapland In Pink Street 15 Mai Amao, Misa Makise

  • mai amao uncensoredcreampiehandjobcaribbeancom
    • 2021-06-04
    59 min

    230OREC-786 Y-chan

  • amateur censoredcreampieuniformorecorec-786orec786230orec-786
    • 2021-06-30
    122 min

    [GVH-254]Shota-kun's Lewd Prank Series: Shota Loves Big Tits, Starring Misa Amagami

  • misa tenjo censoredbig titssingle workGVHglory questtorindoru tanakaGVH-254GVH25413gvh00254
    • 2021-07-14
    217 min

    [DVDMS-692]Neighborhood MILFs With Big, Perky Asses Given A Quickie! 5 - Hot Married Woman Seduced By Stud Into Taking Hard Cock, She Forgets It All For Incredible Orgasms! "You're Still Cumming, Aren't You...？" Her Big Fleshy Asses B

  • censoredcreampieamateurDVDMSdeep sswing nagaseDVDMS-692DVDMS692dvdms00692
    • 2021-08-06
    48 min

    FC2PPV 1962274 [3980 → Limited Number 1980] Saba Saba Sister Working At A Fitness Gym ❤️ Individual Sexual Size From Noon ❤️ Amazing Big ❤️ Nasty Cum ❤️ Simultaneous Cum Shot On Sea Anemone Masterpiece ❤️

  • amateur uncensoredfc2
    • 2021-09-10
    120 min

    [IPX-717]112 Orgasms! 7300cc Of Squirts! A Big Ass Furious Ass-Shaking Piston-Pounding Trance Orgasmic Fuck Kotomi Ono

  • kotoyumi ono censoredsquirtingbeautiful girlIPXidea pocketinaballdishIPX-717IPX717ipx00717
    • 2021-09-10
    120 min

    [SSIS-176]Shared Room NTR A Horny Boss And His New Employee Are Engaged In Adultery Sex From Morning Until Night During A Business Trip Kozue Fujita

  • kozue fujita censoredsquirtingsingle workSSISs1 no 1 stylekitorune kawaguchiSSIS-176SSIS176ssis00176
    • 2021-09-10
    150 min

    [IPX-728]Quickie Blowjob Horny Gal Escort Reverse Pick Up Sex She Takes Whoever She Can Get At Random And Picks Them Up During A Spontaneous Sex Pilgrimage Yume Nishimiya

  • yume nishinomiya censoredcreampieschoolgirlIPXidea pocketmametaro mamezawadishIPX-728IPX728ipx00728
    • 2021-09-20
    90 min

    [KIR-044]The Sister-in-law Of This Big Breasted Sales Lady Was Fired - Rika Tsubaki

  • tsubaki rika censoredcreampiebig titsKIRstar paradisekirei star paradiseKIR-044KIR044h-254kir00044
    • 2021-09-24
    125 min

    [TKSH-022]Beautiful Masochistic Basketball Athlete - Maho Mizukawa

  • maho mizukawa censoredcreampiesingle workTKSHtoyohikozarakiyasushiun kaiTKSH-022TKSH022tksh00022
    • 2021-10-01
    131 min

    [VEO-047][Glitter] Celebrity Kyoko Machimura AV Unleashed

  • kyoko machimura censoredcreampiemature womanVEOvenuskaniebornVEO-047VEO047veo00047
    • 2021-10-02
    22 min

    FC2PPV 2287651 A Mother Of Two Children Who Can’t Stand It And Leaks A Voice Of Joy Beside Her Hungry Daughter

  • amateur uncensoredfc2
    • 2021-10-06
    57 min

    541AKYB-009 Mika (20) Yurufuwa G Cup Girl ♪ (Nazuna Nonohara)

  • amateur censoredbig titssquirtingakybakyb-009akyb009541akyb-009
    • 2021-10-09
    125 min

    [CEMD-064]Lesbian Sexual Carnivores Ayaka Mochizuki and Honoka Tsuji"i Make Passionate Love To One Another With Their Long Tongues!

  • ayaka mochizuki tsujii honoka censoredbig titslesbianCEMDserebu no tomoCEMD-064CEMD064cemd00064
    • 2021-11-05
    81 min

    SMUK-069 Minami (Minami Hironaka)

  • amateur censoredcreampieuniformsmuksmuk-069smuk069smuk-069
    • 2021-11-05
    135 min

    [ROE-017]At the Peak of Maturity. Beautiful Near-50 Married Woman Overturning Conceptions of Age. Honami Matsushima Porn Debut at 48 Years-Old.

  • honami matsushima censoredmature womansingle workROEmadonnamamezawa mametaroumonroeROE-017ROE017roe00017
    • 2021-11-05
    122 min

    [UMD-802]A Married Woman Parties Hard 4 While Her Husband Was Away, This Wife Will Play ... When A Married Woman Gets Busy, She"ll Cum Like Crazy.

  • kiyoshi maihara suzuki mayu censoredbig titshandjobUMDleodoragon nishikawaUMD-802UMD802125umd00802
    • 2021-11-12
    239 min

    [SKMJ-226]A Beautiful Amateur Girl Is Doing Housekeeping At A Man"s House. I"m Not Going To Stop Even If She Comes.

  • censoredcreampieamateurSKMJblush girlyosukeSKMJ-226SKMJ226h-1324skmj00226
    • 2021-11-19
    82 min

    259LUXU-1514 Luxury TV 1485 A Nurse With A Beautiful Smile Appears In Search Of Stimulation, Saying "Normal Sex Is Not Enough …"! The More You Feel It, The More Bewitching It Will Be, And The More You Feel It, The More You Will Repeat Th

  • amateur censoredamateurluxuluxu-1514luxu1514259luxu-1514
    • 2021-12-04
    136 min

    [PKPD-171]A Sleepover At A Girl"s House Documentary Spend The Night At Doe-Eyed And Pretty Erika-chan Ai"s House For The Night, And Experience What It Must Be Like To Be Her Boyfriend Erika Ai

  • love erika censoredcreampiesingle workPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-171PKPD171pkpd00171
    • 2021-12-11
    242 min

    [UMSO-426]16 Beautiful Women With Beautiful Body Lines And Net Tights That Are More Disgusting Than Naked.

  • ichika kamihata ayano kato censoredbig titsUMSOk m produceumanamiUMSO-426UMSO426umso00426
    • 2022-01-13
    105 min

    [FGAN-056]Rio, My Very Own Panty Shot Doll Rio Nakamura

  • rio nakamura censoredcosplaysingle workFGANfetish eyesFGAN-056FGAN056h-1440fgan00056
    • 2022-01-28
    57 min

    [012822_01][VR] 萌えコス淫行三昧 ～癒しのご奉仕メイドをたっぷりご堪能くださいませ～

  • amateur uncensored10musume
    • 2022-01-28
    70 min

    [544IDJS-050]あみ(25) 黒髪美人なドMちゃん

  • amateur censoredcreampieamateuridjsidjs-050idjs050544idjs-050



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored