high visio slender javcensored shaved censored




FC2EBODHZGDNATRAUKGWAAAMIDVMARASTARSMEYDATIDNACRONEZAUKGRBDIPXADNROYDNNPJCESDBBAN

2020-11-13
124 min

[APNS-211]Demeaned Pledged Young Wife Yukino Nagazawa

  • yukino nagasawa censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-211APNS211apns00211
    • 2020-11-13
    238 min

    [ABW-025]She'll Really Fuck You？ Nightclub Hostesses Willing To Go All The Way 17 - Enjoy The Tallest F-Cup In Porn History! An Mitsumi

  • an mitsumi censoredanalbig titsABWprestigemasarupansaabsolutely wonderfulABW-025ABW025118abw00025
    • 2020-11-19
    126 min

    [JRZE-009]Entering The Biz At 50! Miyuki Aoyama

  • miyuki aoyama censoredcreampiemature womanJRZEcenter villageminatoyajurakuJRZE-009JRZE009h-086jrze00009
    • 2020-11-20
    192 min

    [DOCP-258]"Shhh! You Can't Make A Sound... We Need To Keep This A Secret From My Big Sister While We Fuck..." My Wife's Young Sister Seduced Me, And I Tried To Refuse Her Advances By Telling Her, "We Can't Do This!" But

  • is it ran shion censoredcreampiebig titsDOCPprestigedoc premiumDOCP-258DOCP258118docp00258
    • 2020-12-09
    134 min

    [XVSR-568]Love At First Sight: AV Offer - Hana Sato

  • hana satou censoredbig titssingle workXVSRmax asono kancalenXVSR-568XVSR568xvsr00568
    • 2020-12-11
    120 min

    [SUPA-555]The Real Face Of A Married Woman - Yuka-san, 26 Years Old

  • censoredcreampiebig titsSUPAskyu shirotojohnny shibuyaSUPA-555SUPA555h-244supa00555
    • 2020-12-22
    240 min

    [IBW-805]Select Footage Of A Tanned, Barely Legal Beautiful Girl Getting Railed Doggie Style 4 Hours

  • amateur censoredIBWi b worksIBW-805IBW805
    • 2020-12-25
    601 min

    [SKMJ-139]Blushing Babes 2nd Anniversary - 50 Of The Ultimate Amateur Girls - Gentle, Motherly Sex With Male Virgins - 2 Discs, 10 Hours - 78 Creampie Loads - Year-End Special!

  • censoredcreampiebig titsSKMJred face girlSKMJ-139SKMJ139h-1324skmj00139
    • 2020-12-25
    69 min

    300NTK-489 9 Picking up letters to a serious beauty clerk with a body of 170 cm! !! It’s a god-shaped beauty, a beautiful naked demon! ？？ Discovered with a metamorphosis who wants to be seen getting wet in the swimsuit examination! !! Again, fig

  • amateur censoredcreampieamateurntkntk-489ntk489300ntk-489
    • 2020-12-26
    88 min

    300NTK-490 Seriously cute JD advent! !! Even though it is a pink nipple, the sensitivity is Bing fun Momojiri! !! Surprisingly, the blow job is a polite blow job that connects with the skillful sucking! !! If you finger the source of the juice flowin

  • amateur censoredcreampiesquirtingntkntk-490ntk490300ntk-490
    • 2021-01-02
    69 min

    [KBTV-055]Married Woman Shows A Different Face Than In Front Of Her Husband Mrs. Misato

  • censoredmarried womanamateurKBTVclass s amateurKBTV-055KBTV055h-244kbtv00055
    • 2021-01-15
    139 min

    [ZMEN-077]My Bad Girl Little Stepsister Came Home In The Morning After A Night Out And Crawled Into My Futon... 4

  • hasegawa ju yamamoto renka censoredblowjobsisterZMENz mengoro koenjiZMEN-077ZMEN077h-1371zmen00077
    • 2021-01-16
    30 min

    FC2PPV 1647094 30 minutes to blame Yukopi who likes naughty movement

  • amateur uncensoredfc2
    • 2021-02-06
    122 min

    [NKKD-192]Female Boss Made To Share A Room With Her Hung Subordinate On A Business Trip - The Company Has To Cut Costs Somewhere Ai Mukai

  • ai mukai censoredslutsingle workNKKDjet eizomanji groupNKKD-192NKKD192nkkd00192
    • 2021-02-08
    46 min

    FC2PPV 1677960 [Personal shooting] A 41-year-old mature wife who can not control her body that keeps aching sexlessly has become a captive of another stick …

  • amateur uncensoredfc2
    • 2021-02-09
    74 min

    FC2PPV 1678688 * Unauthorized vaginal cum shot Shaved Loli anime voice beautiful girl NTR ♥ Boyfriend’s uterus skewered piston does not reach reason collapse agony acme ♥ A large amount of cheating semen is poured on a dangerous day pussy and cu

  • amateur uncensoredfc2
    • 2021-02-13
    107 min

    [NSPS-967]New Bride Ravished By Other Men From Dawn Until Dusk On Her Honeymoon - Couple Taken Hostage Rei Reiwa

  • rei censoredmarried womandramaNSPSnagae styletaro fujoNSPS-967NSPS967nsps00967
    • 2021-02-23
    59 min

    Pacopacomama 022321_438 Loves Piledriver Position BJ : Rina Suzuki

  • amateur uncensoredpacopacomama
    • 2021-02-28
    135 min

    [KTKL-095]Face-Fucking - Putting My Big-Titted Pet Up For Rent: As Many Creampies As You Want For 0 Yen! Hazuki

  • censoredcreampiebig titsKTKLkitixx mousouzokuloliconKTKL-095KTKL095ktkl00095
    • 2021-03-11
    48 min

    10musume 031121_01 My Friend Encourage Me to Meet This Girl Who Love to be Fucked Mayu Hamada

  • amateur uncensored10musume
    • 2021-04-03
    131 min

    [RPIN-048]Nerdy Girl Who's Become Chubby From Her Indoor Lifestyle Gets Seduced With Lesbian Techniques And Big Dick

  • censoredbig titsRPINlycopene mousouzokukakeru ozoraRPIN-048RPIN048rpin00048
    • 2021-04-14
    162 min

    [DVDMS-655]Ordinary Guys And Girls Caught On Camera - Coworkers With Colossal Tits Get Tipsy, Hit On Their Boss, And Make Him Give Them Creampie Fucks Until Dawn (Role Reversal) 2

  • censoredcreampiebig titsDVDMSdeep sswing nagaseDVDMS-655DVDMS655dvdms00655
    • 2021-04-22
    183 min

    [PIYO-113]I Think There's Something Seriously Fucked Up About Her! (Perverted Desires) - It's Embarrassing To Admit, But I Want To Know How Good It Feels To Fuck. A Mini-Sized Girl From Kansai, 147cm Tall -

  • censoredamateurPIYOhyokopiero daPIYO-113PIYO1131piyo00113
    • 2021-04-24
    161 min

    [TNOZ-004]Titty From Colossal 40" Knockers - Cosplayer, Age 19, Big Tits (5-Some Orgy, 11 Loads) Nipple Orgasms And Deep Throat Face Fucking, Creampie Sex, Screaming Orgasms, Breaking In A Slut Endlessly...

  • censoredbig titscosplayTNOZall japan amateur photographers union daspit uncle 2 all japan kameko cooperatiTNOZ-004TNOZ004tnoz00004
    • 2021-04-24
    158 min

    [LULU-067]My Adorable Girlfriend's Terrifying Stepdad Was Out For The Day, I Spent The Whole Time Nailing Her From Dawn To Dusk - French Kisses And Creampies Wan Horikita

  • horikita wan censoredcreampieschoolgirlLULUlunaticsluminaxLULU-067LULU067lulu00067
    • 2021-04-30
    59 min

    326SCP-026 [Individual Shooting x Tide Death Cosplayer] F-Cup Beautiful Big Breasts Popular Hot Selling Layer Advent! High-flying GAL’s binkan is covered with sperm with vaginal cum shot and facial cumshots to conquer the vagina! !!

  • amateur censoredcreampiesquirtingscpscp-026scp026326scp-026
    • 2021-05-14
    35 min

    359TYVM-155 My grandson is also surprised Shakuhachi Tech 60th birthday Ma ● Co with sperm exploitation mass cum shot! !!

  • amateur censoredcreampiemarried womantyvmtyvm-155tyvm155359tyvm-155
    • 2021-05-21
    109 min

    [HZGD-187]I Love My Wife So Much That I Decided To Ravish Her Rei Kurugi

  • satoshi kuruki censoredcreampiesquirtingHZGDmarried woman flower garden theaterhanukemaru kinpikaimage married woman flower garden theatHZGD-187HZGD187h-1100hzgd00187
    • 2021-05-29
    40 min

    H4610 ori1757 Sayaka Tsubo 20years old

  • amateur uncensoredh4610
    • 2021-06-04
    90 min

    [SS-024]Shining Beauty Himari Kinoshita

  • censoredcreampieamateurSSfine picturesshooting star fine picturesSS-024SS024h-113ss00024
    • 2021-06-15
    123 min

    [KUSE-018]A Real-Life Muscle-Bound Beautiful Girl You*uber Is Getting Her First Raw Creampie! She Got Into Powerful Position To Receive Real Sperm Injected Deep Into Her Pussy!! Yota Chan

  • chanyota censoredcreampiesingle workKUSEsod createzampathis actress style is amazingKUSE-018KUSE0181kuse00018
    • 2021-06-15
    129 min

    [SDAB-182]Asuna Kusunoki: Works At A Maid Cafe, Likes To Draw, Looking For Love SOD Exclusive Porn Debut

  • kusunoki asuna censoreduniformbeautiful girlSDABsod createtiger kosakaione s youthSDAB-182SDAB1821sdab00182
    • 2021-06-26
    120 min

    [XVSR-599]A Prostitute Who Will Definitely Let You Give Her A Raw Creampie Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsXVSRmax ak c takedacalenXVSR-599XVSR599xvsr00599
    • 2021-06-26
    50 min

    Pacopacomama 062621_495 This is My Rule, Just Enjoy Deep Throating! Sakura Kazuki

  • amateur uncensoredpacopacomama
    • 2021-07-02
    68 min

    520SSK-010 Ai

  • amateur censoredcreampieuniformsskssk-010ssk010520ssk-010
    • 2021-07-02
    118 min

    [SSIS-107]Step Sister Suddenly Wants To Fuck! We'd Get In Trouble If We Were Found Out So I Could Only Moan Quietly As She Ravished Me Shion Yumi

  • evening beauty censoredbig titsslutSSISs1 no 1 stylekirinSSIS-107SSIS107ssis00107
    • 2021-07-02
    31 min

    FC2PPV 1898763 Limited number! [Uncensored] Creampie to the kind busty cafe clerk who delivered the forgotten thing! !!

  • amateur uncensoredfc2
    • 2021-07-06
    72 min

    200GANA-2513 Seriously Nampa, first shot. 1659 Bring the young wife who picked up the dropped wad to the hotel! What if I poke a gap in my frustrated heart with my husband …？ Shaking milk! Rippling ass! Nailed to a plump body!

  • amateur censoredbig titsmarried womanganagana-2513gana2513200gana-2513
    • 2021-07-06
    32 min

    493NAEN-084 1 liter of tide! ？？ De M college student! ？？ If you poke it, just poke it and the tide will pop out Sensitive Ma ○ Ko and Gonzo Morishita Mirei

  • amateur censoredamateurbeautiful girlnaennaen-084naen084493naen-084
    • 2021-07-23
    121 min

    [XVSR-607]The Married Woman Makes A Cuckold Of Her Husband While He Is On A Business Trip - Going At It Non-Stop For 26 Hours With Her Neighbor - Hibiki Otsuki

  • otsuki sound censoredcreampiebig titsXVSRmax ak c takedacalenXVSR-607XVSR607xvsr00607
    • 2021-07-23
    40 min

    [frin-042]みさ

  • amateur censoredcreampiebig titsfrinfrin-042frin042frin-042
    • 2021-08-06
    15 min

    FC2PPV 1949687 [4k] Blow Horse Female College Student’S Rich Pacifier Swallowing Cum Swallow Personal Shooting Limited Deletion Schedule

  • amateur uncensoredfc2
    • 2021-08-13
    82 min

    259LUXU-1459 Luxury Tv 1443 A Beautiful Woman In Charge Of Public Relations Of A Certain Company Who Decided To Appear In AV With Interest In Her Eyes Gets Wet In Front Of The Camera And Gets Disturbed! She Will Serve As If She Loves The Big Cock In

  • amateur censoredamateurluxuluxu-1459luxu1459259luxu-1459
    • 2021-08-21
    88 min

    [AGMX-087]Cowgirl Blowjob And Cum Face

  • aoi kururugi chiharu miyazawa censoredblowjobbeautiful girlAGMXsex agentyuuki mogeraAGMX-087AGMX087agmx00087
    • 2021-08-21
    61 min

    1Pondo 082121_001 I Will Teach You How To Handle The Cock In Practice! Kurumi Kokoro

  • amateur uncensored1pondo
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-17
    80 min

    [SS-035]Clairty: Saki Okuda

  • censoredcreampieschoolgirlSSfine picturesSS-035SS035h-113ss00035
    • 2021-10-09
    156 min

    [CMV-159]Sacrificial Anus, Vol. 2. The Anal Worker is a Sobbing Wife who Gets an Enema. Akane Fuji

  • akane kudo censoredanalsingle workCMVcinemagicmarukatsuvixenCMV-159CMV159cmv00159
    • 2021-10-15
    160 min

    [DVDMS-728]Light Skin Big Ass Housewife For A Quickie! Married Woman Lusts For A Big Dick And Decides To Go For It The Next Day To Satisfy Her Need For Non-stop Creampie Fucking - 8. Yui Hatano

  • yui hatano censoredcreampiebig titsDVDMSdeepsfunky haseiDVDMS-728DVDMS728dvdms00728
    • 2021-10-21
    120 min

    [FSDSS-306]A Female S*****t Makes Herself With Her Incontinent Orgasms - Yume Nikaidou

  • nikaido yume censoredbig titssquirtingFSDSSfalenonasty sanchezfaleno starFSDSS-306FSDSS3061fsdss00306
    • 2021-10-29
    108 min

    [ADN-355]I Have Sex With My Father-in-Law... Minami Shiratori

  • minami shiratori censoredsingle workdramaADNattackerstakasugi ryouotona no dramaADN-355ADN355adn00355
    • 2021-11-11
    112 min

    [SPRD-1479]Since that Day When I Slept Next to My Stepmom... Mirei Fujisaki

  • misaki fujisaki censoredmature womansingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1479SPRD147918sprd01479
    • 2021-11-20
    220 min

    [NATR-669]Marumaru Series! Kimika Ichijo

  • mika ichijo censoredcreampiebig titsNATRnadeshikoNATR-669NATR669natr00669
    • 2021-12-09
    117 min

    [NHDTB-608]After Resisting And Pulling Out Just Before A Creampie, This Dick Fucks Her Like Crazy Non-stop While She Gets Her Hips Held Tightly For A Cum Load Deep Inside.

  • censoredcreampiedeepthroatNHDTBnatural highjanken kotamaNHDTB-608NHDTB6081nhdtb00608
    • 2022-01-14
    168 min

    [MIDV-033]It Was Supposed To Be A Sneak Peek At A Porno Shoot, But... Sensitivity Increased! I"m Cumming! I"m Cumming! I"ve Been Corrupted By A Slippery Sexual Massage.

  • flower bud alice censoredsquirtingbeautiful girlMIDVmoodyztrendy yamaguchimoodyz divaMIDV-033MIDV033midv00033
    • 2022-01-15
    130 min

    [GVH-348]Stepmother And Offspring Sex. Ayaka Muto

  • ayaka muto censoredcreampiemature womanGVHglory questtakahashi chitsujiGVH-348GVH348gvh00348



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored