high vision big butt jav creampie tits




FC2AWDMIAAABWGVHADNPPPDAVSAFSDSSWAAAGMEMNACXWANZMIDECJODRBDHNDROYDNNPJSHKDAMBI

2020-10-09
73 min

FC2PPV 1528225 [Millionaire’s play] Nasty celebrity wife 25 years old, a beautiful woman with 5 saffles and the best pussy. Nipple licking stakeout piston and acme. Mating to squeeze all sperm from a 20-year-old man [Personal shooting]

  • amateur uncensoredfc2
    • 2020-10-10
    157 min

    [DASD-742]Breaking In My Stepsister In Bed - 100 Days Of Memories Caught On Camera Eimi Fukada

  • emi fukada censoredsingle workdramaDASDdashiromichi hoseDASD-742DASD742dasd00742
    • 2020-10-16
    256 min

    [DNW-099]No More Daddy Issues! [Tricking An Insolent Daughter To Eat Her Pussy] 02

  • censoredcreampiebig titsDNWprestigedocument nowDNW-099DNW099118dnw00099
    • 2020-10-17
    119 min

    [SSNI-903]My Boss Was Away On A Business Trip For Three Days, So I Creampied His Wife Again And Again! With Miu Nakamura

  • miu nakamura censoredcreampiesingle workSSNIs1 no 1 stylezaku araiSSNI-903SSNI903ssni00903
    • 2020-10-18
    146 min

    [LZWM-031]Nipple Loving Lesbians - Tweaking, Teasing, Tugging Lady Loving

  • june lovejoy oda mako censoredbig titslesbianLZWMlesrerikachang manlezure playLZWM-031LZWM031lzwm00031
    • 2020-10-20
    139 min

    [SDJS-086]Shooting The Sexual Adultery Of 3 Married Female SOD Employees! These Sexually Frustrated Women Get Excited By Other Dicks Than Their Husbands'...

  • censoredamateurmature womanSDJSsod createkomatsu 17sod female employeeSDJS-086SDJS0861sdjs00086
    • 2020-10-23
    302 min

    [MKMP-360]Teruta Yumemi - Dream History Classic

  • yumemi teruuta censoredcreampieblowjobMKMPk m producek taromillionMKMP-360MKMP36084mkmp00360
    • 2020-11-14
    251 min

    [LHTD-011]Take On The Challenge! The Big Vibrator Timer Shizuku Momoka Akane

  • asahi dro yoshino momoka censoredLHTDocean bookslight houseLHTD-011LHTD011171lhtd00011
    • 2020-12-05
    89 min

    [sdgn-009]さりなちゃん(21)

  • amateur censoredcreampiebig titssdgnsdgn-009sdgn009sdgn-009
    • 2020-12-06
    240 min

    [YLWN-143]Carnal Relations With My Mother-In-Law - The Story Of How She Seduced Me 4 Hours

  • censoredamateurmature womanYLWNyellow moonpappan tateishiYLWN-143YLWN143ylwn00143
    • 2020-12-21
    45 min

    FC2PPV 1592280 [Limited quantity 2400pt → 1200pt] Realistic GoPro video and iPhone high-quality vertical video ❤️ Immediate scale with clothes knit dress ❤️ Slender beauty Constricted Sarah beauty BOBY ❤️ Purchase privilege available

  • amateur uncensoredfc2
    • 2020-12-31
    240 min

    [OFJE-292]Stunningly Beautiful Girls Try Their Best Techniques To Get Guys Off - Other Than Sex! Cocks Lovingly Lavished With Attention - Pleasure Like Never Before - 150 Loads

  • nanatsumori riri arisu aka censoredbig titsblowjobOFJEs one number one styles1 no 1 styleOFJE-292OFJE292ofje00292
    • 2021-01-15
    42 min

    359TYVM-121 Forty G Breasts Beautiful Wife Electric Ma Cum Continuous Cum Shot Sex! !!

  • amateur censoredcreampiebig titstyvmtyvm-121tyvm121359tyvm-121
    • 2021-01-15
    80 min

    FC2PPV 1646453 [First time limited 1980] Club picked up club love active JD ❤️ I was allowed to take a gonzo when I was in contact ❤️ Full erection with self-Irama ❤️ A large amount of vaginal cum shot with a meat stick woofer ❤️

  • amateur uncensoredfc2
    • 2021-01-20
    118 min

    [OFKU-172]The Bride's Mother Who Came To Tokyo From Miyagi... 50-something Stepmom - Rumi Nitta

  • rumi nitta censoredcreampiemature womanOFKUstar paradisemom railOFKU-172OFKU172h-254ofku00172
    • 2021-01-22
    85 min

    383REIW-047 Miki

  • amateur censoredcreampiebig titsreiwreiw-047reiw047383reiw-047
    • 2021-02-05
    115 min

    [PARATHD-3100]The Reason Why This Sixty-Something Widow Secretly Filmed Her Stepdaughter And Her Husband's Nightly Activities Deluxe Edition - When He Found Out The Reason, Her Son-In-Law Decided To Provide His Own Brand Of Comfort -

  • censoredamateurmature womanPARATHDparadise tvPARATHD-3100PARATHD3100parathd03100
    • 2021-02-08
    57 min

    [ETQR-192](Daydream POV) Raw Creampie Sex With A Barely Legal Beautiful Girl In A School Sailor Uniform. Kanna 02

  • censoredcreampieuniformETQRerotic timeETQR-192ETQR192h-1186etqr00192
    • 2021-02-11
    121 min

    [FSDSS-170]Their Genes Want Each Other, Instinctual Fucking, Uncut Collection Ayaka Tomoda

  • ayaka tomoda censoredcreampiesquirtingFSDSSfalenopremium takanofaleno starFSDSS-170FSDSS1701fsdss00170
    • 2021-03-06
    48 min

    FC2PPV 1713662 Active underground idol N ☆ Emergency shooting! 3P continuous vaginal cum shot in the king game ♡ Review privilege is 4K ☆ Virgin Ichikoro sweater … (*’艸 ｀)

  • amateur uncensoredfc2
    • 2021-03-09
    62 min

    345SIMM-619 A busty wife who is chased by child-rearing exposes a nasty figure that her husband does not even know!

  • amateur censoredcreampiebig titssimmsimm-619simm619345simm-619
    • 2021-03-21
    119 min

    [JUL-513]Raw Sex With A Married Maid Who Will Do Whatever You Want

  • karen sasahara censoredcreampiemature womanJULmadonnarokusaburo mishimaJUL-513JUL513jul00513
    • 2021-03-26
    175 min

    [ABW-071]Super See-Through Slutty Academy CLASS 10 Hot And Steamy Sex With Bodies Under See-Through Clothing For See-Through Fetishists!

  • yuki rumina censoredsquirtingcosplayABWprestigecharlie nakataabsolutely wonderfulABW-071ABW071118abw00071
    • 2021-03-27
    134 min

    [NINE-047](Rare Goods Received: Young Cutie With J-Cup Tits) Office Slut With Colossal Tits Starts A Secret Date Club - Leaked Hidden Camera Footage.

  • censoredbig titsamateurNINEmercurychateaubriand hutNINE-047NINE047h-1133nine00047
    • 2021-04-02
    115 min

    [PARATHD-3160]The "Adult" Telephone Consultation Room, Where You Must Not Ever Cum A Paradise TV Female Anchor Is Cumming Her Brains Out! Complete Edition

  • yuuri saki mizumi censoredPARATHDparadise tvPARATHD-3160PARATHD3160parathd03160
    • 2021-04-09
    53 min

    FC2PPV 1761781 [That girl] A typical modern JD 19-year-old cum swallow that I saw somewhere recently.

  • amateur uncensoredfc2
    • 2021-04-18
    245 min

    [AVSA-165]Breaking In The Queen's Masochistic Men: 4 Hours BEST vol. 2

  • rino kirishima reiko sawamura honami takasaka masumi takasaka censoredbdsmAVSAavs collector smariannuavscollector sAVSA-165AVSA165avsa00165
    • 2021-04-28
    58 min

    517MQXT-004 A Beautiful Girl Who Crawls On All Fours After Administration Of An Aphrodisiac And Is Asked For A Shame Hole And Shakes

  • amateur censoredschoolgirlamateurmqxtmqxt-004mqxt004517mqxt-004
    • 2021-04-30
    61 min

    Caribbeancom 043021-001 Dynamite: Non Suzumiya

  • non suzumiya uncensoredcreampiecaribbeancom
    • 2021-05-07
    66 min

    383REIW-062 Narumi

  • amateur censoredcreampiebig titsreiwreiw-062reiw062383reiw-062
    • 2021-05-07
    168 min

    [IPX-660]If You Don't Want To Get Into Trouble, Then Take Off Your Panties. Dirty Shoplifting Gals ... The Tragedy Of Relentless Piston-Pounding Pussy Pumping That Won't Ever Stop, No Matter How Many Times He Cums, And He Won't Ever Let H

  • kana momonogi censoredblowjobbeautiful girlIPXidea pocketkyoseidishIPX-660IPX660ipx00660
    • 2021-05-13
    160 min

    [ABW-091]綺麗なお姉さんの完全エスコートSEX 年下くんを性の悩みから解放するドキュメント 松岡すず 【MGSだけのおまけ映像付き 20分】

  • amateur censoredamateurcosplayabwabw-091abw091abw-091
    • 2021-05-19
    75 min

    259LUXU-1424 Luxury TV 1406 De M Nasty Tutor Appears In AV In Search Of A New Experience! Shake your body with a violent piston that is repeated many times, and spree while jumping beautiful big tits full of elasticity!

  • amateur censoredbig titsamateurluxuluxu-1424luxu1424259luxu-1424
    • 2021-06-01
    62 min

    C0930 ki210601 Akiko Nishida 43years old

  • amateur uncensoredc0930
    • 2021-06-01
    59 min

    1Pondo 060121_001 Seducing by Flashing Pussy: Nagisa Shinohara

  • amateur uncensored1pondo
    • 2021-06-04
    121 min

    FC2PPV 1851765 980 yen! The contents are full ♪ After all, an angel! ？？ All you want to do for a beautiful girl with big breasts ♪ Full of back ops (rimming, facial cumshots, electric drill, anal fingering) Angel Naten-chan gets sharp？ One vaginal cu

  • amateur uncensoredfc2
    • 2021-06-17
    240 min

    [VENX-050]"Do Older Lady Panties Excite You？" Step Aunt Drains Her Step Nephew Dry Of Every Last Drop Of Cum With Her Fresh Panties Highlights

  • censoredcreampiemarried womanVENXvenusincestVENX-050VENX050venx00050
    • 2021-06-18
    88 min

    277DCV-184 Is it okay to send it home？ case.178 The moment of insertion is irresistible! A big smile … A gal who said "I’m so excited …" "I’m dying because it feels so good …" ⇒ Good! Good sensitivity! Iku

  • amateur censoredamateurdcvdcv-184dcv184277dcv-184
    • 2021-06-19
    62 min

    10musume 061921_01 The Structure Of Woman : Measuring Size of My Boobies! Seiko Matoba

  • amateur uncensored10musume
    • 2021-06-22
    66 min

    324SRTD-0230 Super Cute Classmate And Second Party SEX! ？？ "Please go outside"

  • amateur censoredcreampieamateursrtdsrtd-0230srtd0230324srtd-0230
    • 2021-06-24
    145 min

    [IENF-149]You'll Be Able To Clearly See Everything, Even Down To The Number Of Anal Wrinkles On Her Ass! No Mosaic Censoring A Consecutive Orgasmic Anal Masturbation Show-Off 2

  • asahi drop aya mitsuki censoredanalIENFienergyienfIENF-149IENF1491ienf00149
    • 2021-06-29
    37 min

    248HDG-492 Video Nana Goes Crazy When Her Husband Sees

  • amateur censoredmarried womanamateurhdghdg-492hdg492248hdg-492
    • 2021-07-10
    122 min

    [LUNS-074]Immoral Fuck Ravaging The Bride's Mother 6

  • censoredcreampiemature womanLUNSluna shunkoshaLUNS-074LUNS074luns00074
    • 2021-07-14
    120 min

    [SPRD-1442]Coming Inside Stepmother For The First Time, Starring Mizukami Yukie

  • mizukami yukie censoredmarried womansoloworkSPRDtakara eizokyuta tukumoaleddinSPRD-1442SPRD1442
    • 2021-07-14
    117 min

    [MVSD-471]Remote Control Cuckoldry: Listening To My Beloved Wife Moan As She Is Taken By Another Man, Starring Michiru Kujo

  • kujo michiru censoredcreampieblowjobMVSDm s video groupbungo maedaMVSD-471MVSD471mvsd00471
    • 2021-08-01
    120 min

    [NACR-445]My C***dhood Friend Is My Submissive Pet Haruki Ashina

  • haruki ashina censoredblowjobsingle workNACRplanet plussakura ninshichi ku ryuuNACR-445NACR445h-237nacr00445
    • 2021-08-14
    41 min

    404DHT-0091 Yarimoku Forty Mature Woman Momoka 45 Years Old Fishing A Man On Sns

  • amateur censoredcreampieamateurdhtdht-0091dht0091404dht-0091
    • 2021-08-21
    117 min

    [AGAV-060]The Best Colossal I-cup Tits Are Jiggling Up And Down With A Super Explosive Piston Fuck - Rui Miura

  • rui miura censoredbig titssingle workAGAVsex agentyoshida daibutsuAGAV-060AGAV060agav00060
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-17
    120 min

    [PRED-337]Training Camp NTR Cheating Scenario (Exclusive Actress Special!) College Girlfriend Hooks Up With A Player For Infidelity And Creampie Footage. Ai Hoshina

  • sena ai censoredcreampieblowjobPREDpremiummorutsu kunelegancePRED-337PRED337pred00337
    • 2021-09-19
    79 min

    522DHT-0302 Living In Minami Aoyama X 3rd Year Marriage Big Breasts Wife Creampie Her Kana 30 Years Old

  • amateur censoredbig titsmarried womandhtdht-0302dht0302522dht-0302
    • 2021-09-24
    120 min

    [DFDM-023]Super Close-up! Fleshy Oil Beauty Treatment Salon - Yuria Yoshine

  • yoshine yuria censoredbig titsblowjobDFDMwaap entertainmenteightfearlessDFDM-023DFDM0232dfdm00023
    • 2021-09-29
    126 min

    300MIUM-741 A Summer Trip To Tateyama Where The Fair-Skinned G Cup Is Too Dazzling! Sex While Being Excited By The Tongue Licking Soft Serve Ice Cream And The Sharp Body That The Swimsuit Shines! !! A Swallowing Blow Job That Loves All Ji ● Ko Equall

  • amateur censoredcreampiesquirtingmiummium-741mium741300mium-741
    • 2021-10-11
    72 min

    533NNS-012 Drunk Angel Beautiful Girl Muchimuchi Beautiful Legs & Nice Bottom Excited! !! Two Vaginal Cum Shots! !! Drunk And Masturbation Released! !! Immediately Insert Raw Sp Into A Lively Pussy! !!

  • amateur censoredcreampiebig titsnnsnns-012nns012533nns-012
    • 2021-10-30
    168 min

    [SORA-342]S*****t Council President Is A Natural Exhibitionist - Orgy Bad Ending Edition ~ Mizuki Yayoi

  • mizuki yayoi censoredschoolgirlsingle workSORAyama to sorausubashi suiSORA-342SORA342sora00342
    • 2021-12-08
    71 min

    546EROF-010 [Leaked] I Cup Gravure Gonzo Leaked And Stored Video Boobs Bouncing With The Impact Of The Climax (Hana Himesaki)

  • amateur censoredcreampiebig titseroferof-010erof010546erof-010



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored