high vision black actor javcensored jav




FC2BBANAUKGABWWAAAKBIONEZNGODIPXFSDSSHODVHNDHZGDSQTEDASDDTTHDKAGMEMSSISPPPDVEMA

2020-11-13
193 min

[BAZX-257]I Had Serious Fuck Fest Sex With A Lactic Acid D***k Sales Lady That I Would Always See Around My Neighborhood vol. 005

  • censoredcreampieuniformBAZXbazookatodoBAZX-257BAZX257h-1496bazx00257
    • 2020-11-24
    61 min

    FC2PPV 1582057 [Re-shooting OK! ] [4K shooting] I was able to persuade him on the condition that he would be deleted immediately if he got caught.

  • amateur uncensoredfc2
    • 2020-12-10
    285 min

    [HZMEN-005]After Missing My Last Train Home, My Lady Boss Put Me Up For The Night, And When I Saw Her With No Makeup On, She Looked So Cute, I Unexpectedly Got A Super Hard On! And Then I Fucked Her And Splattered Her Pretty Face With Bukkake Semen S

  • emi kuromiya akari shinmura censoredHZMENz mennabeHZMEN-005HZMEN005h-1371hzmen00005
    • 2020-12-10
    63 min

    413INST-077 Tomomi-chan, 21 years old ☆ Chi ● A devil’s rotor three-point blame on a milk dollar BODY that makes you squeeze ♪ Bikubiku cum man juice betting! G-spot Goryu Egg and serious soup dripping seeding complete agreement Peace sign ♪ Mou

  • amateur censoredcreampiebig titsinstinst-077inst077413inst-077
    • 2020-12-29
    139 min

    [STARS-311]Cowgirl Practice With The Busty Babe In The Next Room Hibiki Natsume

  • natsume hibiki censoredbig titssingle workSTARSsod createkyoseisod starSTARS-311STARS3111stars00311
    • 2021-01-05
    241 min

    [BUR-562]Pussies Lavished With Tongue! 108 Cunnilingus Orgasms 4 Hours

  • censoredschoolgirlbeautiful girlBURglay zburst graceBUR-562BUR56212bur00562
    • 2021-01-06
    66 min

    [sika-010]もも 2(18)

  • amateur censoredcreampieamateursikasika-010sika010sika-010
    • 2021-01-08
    58 min

    FC2PPV 1636451 [No] Model-shaped lady Hina, 21 years old, is inserted in the mouth for a walk date ♡! !! 【selfie】

  • amateur uncensoredfc2
    • 2021-01-16
    139 min

    [MXGS-1167]Beautiful Big Tits With Mesmerizing Bounce - Passionate, Loving Sex With An I-Cup Hana Himesaki

  • himesaki hana censoredbig titsbeautiful girlMXGSmaxingMXGS-1167MXGS1167h-068mxgs01167
    • 2021-01-19
    140 min

    [SDJS-102]These Two New Female Employees Haven't Had Sex For A Whole Month, And Now They're About To Get Fucked By Male Porn Stars For One Whole Day! Over 100 Orgasms! Lust Unleashed: The Most Sex Of Their Lives - SOD Female Employees Kotoha

  • kotoba nakayama miyazaki rin censoredamateurbeautiful girlSDJSsod createakira saijosod female employeeSDJS-102SDJS1021sdjs00102
    • 2021-01-22
    31 min

    [BTH-111]Feel My Squirting Seed Juria Tachibana

  • tachibana risa censoredblowjobbukkakeBTHchobitchchovicBTH-111BTH111h-1435bth00111
    • 2021-01-23
    156 min

    [JUKF-054]Only Busty Girls - Stepsister For Rent Rika-Chan Rika Tsubaki

  • tsubaki rika censoredcreampiebig titsJUKFjumpjump avJUKF-054JUKF054h-227jukf00054
    • 2021-02-05
    53 min

    417SRYA-001 [Erotic ass x 2 beautiful women] I haven’t heard that the instructor teacher is so naughty (sweat)! !! Look at the sexy ass! Rubbing! Be sandwiched! At the end, insert raw cheeks into 2 beautiful women … Thanks to you, I am stil

  • amateur censoredcreampiebig titssryasrya-001srya001417srya-001
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-18
    119 min

    [SSNI-999]Sexy Costume Non-Nude Erotica Star Akua Yamazaki Can't Resist Her Gropers... Barely Legal Teen Ravished In 5 Situations

  • mizuyama yamazaki censoredbig titsbeautiful girlSSNIs1 no 1 stylekyoseiSSNI-999SSNI999ssni00999
    • 2021-02-20
    54 min

    324SRTD-0213 A female student who hasn’t bloomed yet but can get a glimpse of the de M

  • amateur censoreduniformamateursrtdsrtd-0213srtd0213324srtd-0213
    • 2021-02-25
    58 min

    H4610 ki210225 Miyuki Takizawa 21years old

  • amateur uncensoredh4610
    • 2021-03-04
    83 min

    [HONE-257]I Was Watching My Stepmom's Dripping Wet Nipples. Natsumi Omachi

  • natsumi omachi censoredcreampiemature womanHONEcenter villageminatoyahanazono center villageHONE-257HONE257h-086hone00257
    • 2021-03-10
    55 min

    326HGP-019 This woman is amazing! !! Capture a drunken G milk student from early morning after the cabaret bite ☆ Bring it to the hotel and insert unauthorized raw! A climax trance on the verge of hyperventilation of the G cup swaying with a series o

  • amateur censoredcreampiebig titshgphgp-019hgp019326hgp-019
    • 2021-03-17
    135 min

    [GVH-208]A Beautiful Teacher Entering A Nest Of No-good S*****ts - Miyabi Midorikawa

  • midorikawa miyabi censoredsingle workGVHglory questhajime kimuraGVH-208GVH20813gvh00208
    • 2021-03-19
    190 min

    [DOCP-280]"I'll Do Anything You Need Me To, Okay？" I Got Laid Up From An Injury And My Younger Stepsister Was Left To Bathe Me! I Got Hard When She Cleaned Under My Stuck Foreskin, And This Made Her So Horny That She Couldn't Hide It

  • moe hazuki saya matsui censoredcreampiebig titsDOCPprestigedoc premiumDOCP-280DOCP280118docp00280
    • 2021-03-21
    118 min

    [NNPJ-438](*A Super Rare Discovery That You Can Only See Right Now) A Big Tits College Girl (Estimated Titty Size: J-Cup) Who Is Currently Studying Overseas Is Learning About The State Of Society And Immediately Cumming Home To Star In This Adult Vid

  • censoredcreampiebig titsNNPJnanpa japanNNPJ-438NNPJ438nnpj00438
    • 2021-04-03
    168 min

    [DNJR-048]Slutty Friends! Two Girls Share Wet Kisses And Suck On My Cock!

  • okawa tsukino yuka mitsuha censoredblowjobslutDNJRdog daydreamersmaboroshikoDNJR-048DNJR048dnjr00048
    • 2021-04-08
    60 min

    10musume 040821_01 Girl in Love with the Freaky Play Squirted Fumi Saito

  • amateur uncensored10musume
    • 2021-04-09
    167 min

    [MIFD-153]I Want To Draw My Own Sex! Fresh Face Porn Debut - Cute & Boyish Mai Kagari, Age 20

  • flower hunting censoredbeautiful girlsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-153MIFD153mifd00153
    • 2021-04-09
    156 min

    [JUFE-280]My Special Summer Vacation With My Teacher... Beautiful Y********l In Uniform With H-Cup Tits Takes Middle-Aged Sperm Nenne Ui

  • first love censoredbig titssquirtingJUFEfitchJUFE-280JUFE280jufe00280
    • 2021-04-13
    57 min

    438PVMK-010 Tsukasa

  • amateur censoredamateurpvmkpvmk-010pvmk010438pvmk-010
    • 2021-04-17
    239 min

    [REXD-359]We Discovered A Pervert In The Neighborhood! Woman Who Films Herself Masturbating Is Found Out By The Location Of Her Beauty Mark!

  • censoredcreampieblowjobREXDredmanji groupREXD-359REXD359rexd00359
    • 2021-04-21
    35 min

    492JCHA-015 Well, I’m always picking up

  • amateur censoreduniformschoolgirljchajcha-015jcha015492jcha-015
    • 2021-05-02
    46 min

    188HINT-0453 Chiaki

  • amateur censoredmarried womansquirtinghinthint-0453hint0453188hint-0453
    • 2021-05-04
    70 min

    200GANA-2487 Seriously Nampa, first shot. 1631 This time at the shooting studio, not at the hotel! H individual photo session with cosplay girls found in Akihabara! Yin and Yang who love 2D also fall into the vagina with a big cock and there is no wa

  • amateur censoredamateurcosplayganagana-2487gana2487200gana-2487
    • 2021-05-05
    38 min

    279UTSU-504 Ayumi-san

  • amateur censoredcreampiebig titsutsuutsu-504utsu504279utsu-504
    • 2021-05-07
    125 min

    [EBOD-825]I Got My First Girlfriend, And When I Took Her Clothes Off ... I Could Never Imagine What An Amazing Small Waist She Had, And Those Big Tits I Was So Super Excited That I Kept On Fucking Her Until I Drained All Of The Lust From My Balls Kok

  • asakura here censoredbig titsblowjobEBODe bodymichiru arashiyamaEBOD-825EBOD825ebod00825
    • 2021-05-14
    241 min

    [MMB-366]The Gaping 24-Pussy Grand Prix - Which Hot -Porn Star Can Cum The Most？! - Six Months Across France For The Most Famous International Four-Legged Tour De Fuck! This Year Japan Is Hosting And Momotaro's 24 Smoking Representatives Await Ea

  • kurata mao hamazaki mao censoredbeautiful girlslutMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-366MMB366mmb00366
    • 2021-05-15
    61 min

    1Pondo 051521_001 Seducing by Flashing Pussy: Miyu Morita

  • amateur uncensored1pondo
    • 2021-06-16
    115 min

    [083PPP-2166]よく締まったおしりの体育大女子学生を性感マッサージでとことんイカせてみた豪華版(1)

  • amateur censoredamateurpppppp-2166ppp2166083ppp-2166
    • 2021-07-02
    33 min

    520SSK-016 Kanna

  • amateur censoredcreampieamateursskssk-016ssk016520ssk-016
    • 2021-07-29
    64 min

    FC2PPV 1946187 [Endless Fainting & Convulsions] A Conscious Big Ass Married Woman Who Goes To A Yoga Class. Immediately On The Way Home From The Classroom, A White-Eyed Ahegao Screaming Screaming Acmeiki Crazy Vaginal Cum Shot Fuckin ♡ [Crazy]

  • amateur uncensoredfc2
    • 2021-08-10
    90 min

    484SDGN-016 God Body Shop Clerk I Like Raw! I Like Eroticism! I Have Made A Vaginal Cum Shot On A Pie Bread That Has Accumulated Sexual Desire After Drinking Alcohol!

  • amateur censoredcreampieamateursdgnsdgn-016sdgn016484sdgn-016
    • 2021-09-17
    118 min

    [MEYD-703]My Father-in-Law Gave Me A Quick Creampie While My Husband Went Out For A 5-minute Smoke Break. Ejaculating 10x Each Day For A Pregnancy. Hotaru Nogi

  • nogi firefly censoredcreampiebig titsMEYDtameike goromishima rokusaburoMEYD-703MEYD703meyd00703
    • 2021-09-18
    136 min

    [EVIS-370]The Smell Of A Mature Female Body: Lesbians Giving Cunnilingus While Smelling And Tasting Panties Filled With Pussy Juices

  • yuka saeki otsu alice censoredlesbianEVISebisusan mousou zokucherry miyamaEVIS-370EVIS370evis00370
    • 2021-09-22
    74 min

    533NNS-007 White Gal Beauty Birthday Festival! !! Creampie Continuous Inevitable Plump Beauty Huge Breasts! !! Shaking Gal Milk Umee Ww Sperm Beauty Man Leaked Video With Continuous Shooting! !! Masturbation Too Much Alarm WW

  • amateur censoredcreampiebig titsnnsnns-007nns007533nns-007
    • 2021-09-23
    67 min

    SIRO-4639 [First Shot] [Active Nursery Teacher] [H Cup Married Woman] Discovered A Married Active Nursery Teacher With A Wonderful Healing Smile Full Of Motherhood. The Body That Was Hungry For Being Blamed Receives The Relentless Caress Of A Man And

  • amateur censoredbig titsmarried womansirosiro-4639siro4639siro-4639
    • 2021-10-01
    61 min

    FC2PPV 2280443 * Until 10/3 4980⇒2980 ★ Popular ☆ Virgin Brush-Down Project! That Incredible Beautiful Girl ♥ Lara Participates In The War ☆ Eating Two Amateur Virgins ♥ Thick Blowjob On The Verge Of Outburst ♥ I Can Not Stand It And I Can Not Stand

  • amateur uncensoredfc2
    • 2021-10-01
    66 min

    324SRTD-0250 Big Ass Woman Who Betrays Her Boyfriend With Drunk Momentum And Enjoys It Live (Renka Yamamoto)

  • amateur censoredcreampiebig titssrtdsrtd-0250srtd0250324srtd-0250
    • 2021-10-02
    137 min

    [PKPT-004]Newcomer Home Sipping Documentation, Cool And Slender Newcomer Hottie, Mia Hanesaki

  • mia hasaki censoredcreampiebeautiful girlPKPTpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPT-004PKPT004pkpt00004
    • 2021-10-02
    101 min

    [SQTE-384]Creampie Sex With H-cup Otaku Madoka - Madoka Shizuki

  • madoka shizuki censoredcreampiebig titsSQTEs cutes cute s cuteSQTE-384SQTE384sqte00384
    • 2021-10-15
    237 min

    [MIZD-252]See Her Hot Face And All The Action In Full View! Sexy Angles While Fucking Her Deep From Behind. Best Of.

  • nanasawa mia shoko takahashi censoredcreampiesquirtingMIZDmoodyzmoodyz bestMIZD-252MIZD252mizd00252
    • 2021-11-05
    118 min

    [JUL-771]Chance Reunion With Sexual Harassment Teacher From S*****t Days as Prostitute. From That Day Made To Become a Subservient Pet... Nana Hayami

  • don t be quick censoredmature womansingle workJULmadonnashouten shirouJUL-771JUL771jul00771
    • 2021-11-09
    37 min

    C0930 ki211109 Noriko Ichikawa 44years old

  • amateur uncensoredc0930
    • 2021-11-26
    91 min

    300MIUM-767 I Happened To Find The City Of Shinjuku, Which Is Crowded On The Eve Of Halloween, And I Accidentally Found An E-Cup Tipsy Beauty With A Nice Body. !! It’s The First Time For A Giant Chin For More Than 100 Experienced People! ？？ The

  • amateur censoredamateurcosplaymiummium-767mium767300mium-767
    • 2021-12-01
    76 min

    230OREC-949 Misuzu-San (Misuzu Mifune)

  • amateur censoredcreampiebig titsorecorec-949orec949230orec-949
    • 2021-12-10
    24 min

    FC2PPV 2504844 Immediate Scale 3 People Continuously Mass Fired In The Car Dedicated To Blowjob In The Middle Of The Day. Finally Live In The Car, It Feels Too Comfortable And A Large Amount Of Vaginal Cum Shot ☆ Mizuki-Chan, A Beautician Who Likes B

  • amateur uncensoredfc2
    • 2022-01-13
    117 min

    [DLDSS-050]Cum Because Of Your Nipples! With Just Nipple Play, She Makes The Guy Cum. Tina Nanami.

  • nanami tina censoredslutsingle workDLDSSdahliatake dDLDSS-050DLDSS0501dldss00050
    • 2022-01-14
    286 min

    [DVDMS-760]Face Reveal! Magic Mirror Service. Beautiful Women Who Work At An Elite Beauty Salon. First-time Testicle Massage Edition. Full-on Sex Special For All 8 People! Carefully Massaging Those Balls Like Never Before, Making That Big Dick Get So

  • censoredamateurDVDMSdeepsfunky haseithe magic mirrorDVDMS-760DVDMS760dvdms00760
    • 2022-01-15
    120 min

    [KSBJ-178]A Week Where I Was Repeatedly Fucked By My Husband"s Junior - Nene Tanaka

  • nene tanaka censoredcreampiebig titsKSBJksb kikaku emmanuellesakura ninKSBJ-178KSBJ178ksbj00178



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored