high vision censored housewife javcensored nampa




FC2GMEMHZGDPPPDNNPJMEYDBLKWAAACHRVKSBJMIDEGVHHMNAWDMILKSPRDCAWDSQTEWANZVEMAAUKG

2020-10-01
30 min

FC2PPV 1519177 [Individual shooting 24] Complete appearance 19 years old Slender shaved sujiman ⑨ Creampie with outdoor exposure

  • amateur uncensoredfc2
    • 2020-10-03
    240 min

    [HUNTA-867]"Give Me More" "I Know You Can Still Fuck, Right？" I Was At Home With My 2 Big Tits Horny Lady Bosses. And Then I Became The Meat In A Big Tits Sandwich And They Made Me Ejaculate Until The Break Of Dawn.

  • censoredcreampiebig titsHUNTAhunterkawajirihhh groupHUNTA-867HUNTA867hunta00867
    • 2020-10-06
    130 min

    [STARS-260]She's Booked In The Same Hotel Room With Her Cherry Boy Employee This Lady Boss At A Cosmetics Company Gave Him Sloppy Kissing Sex Until The Break Of Dawn Yuna Ogura

  • yuna ogura censoredsingle workSTARSsod createdragon nishikawasod starSTARS-260STARS2601stars00260
    • 2020-10-19
    65 min

    328HMDN-304 Kanna

  • amateur censoreduniformschoolgirlhmdnhmdn-304hmdn304328hmdn-304
    • 2020-10-31
    171 min

    [WAAA-010]Erotic Massage Master Turns A College Girl's Whole Body Into An Ultra Sensitive Erogenous Zone And Makes Her Cum Until She Swoons... Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiesingle workWAAAwanz factorywanzWAAA-010WAAA010waaa00010
    • 2020-11-01
    100 min

    [VENU-972]One Night And Two Days When I Was Suddenly Overtaken By My Wife's Sister - Nene Tanaka

  • nene tanaka censoredcreampiebig titsVENUvenussarufakecest winntersVENU-972VENU972venu00972
    • 2020-11-16
    70 min

    [YMDS-009]Hot Amateur Interview Quickie - She Only Came For A Chat And Wound Up Getting Pounded (30-Year-Old Miya)

  • censoredcreampieamateurYMDSmomotaro video publishingasakusa is jiroyoung peachYMDS-009YMDS009ymds00009
    • 2020-12-18
    481 min

    [KPB-013]18 Specially Rich And Thick Semen Cum Shots Deep Into The Pussy Of A Married Woman!! KANBi Best Hits Collection 8 Hours Vol.03 Immoral Raw Sex With A Beautiful And Horny Married Woman!!

  • censoredcreampiemarried womanKPBprestigekanbiKPB-013KPB013118kpb00013
    • 2020-12-21
    157 min

    [CESD-958]Young Wife Broken In By Her Husband's Boss With Kisses Momo Kato ka

  • kato momoka censoredmature womansingle workCESDceleb no tomoCESD-958CESD958cesd00958
    • 2020-12-23
    21 min

    FC2PPV 1617518 [No] M man is blown by the popular Misa-chan with two big cocks in a row

  • amateur uncensoredfc2
    • 2020-12-26
    149 min

    [IKST-007]If You Wanna Cum To Beautiful Tits Look Here! The BEST Of Yayoi Selected Just For You! Premium Selection With Many Super Rare Scenes! Yayoi Yanagida

  • yanagida yayoi censoredcreampiebig titsIKSTsuddenly eroticIKST-007IKST007h-1454ikst00007
    • 2021-01-02
    56 min

    [KBTV-056]We Wanted Test This Theory: Is It Easy To Fuck Girls Who Don't Have Boyfriends But Walk Around With Condoms In Their Purses？

  • censoredamateurKBTVmessy tvKBTV-056KBTV056h-1514kbtv00056
    • 2021-01-09
    118 min

    [MEYD-646]This Auntie Is A Former Slut And She's So Sexy That Her Super Skinny Nerdy Nephew Has Transformed Into A Sexual Monster! He's Got Her In A Super Orgasmic Pregnancy Fetish Hold From Which She Can Never Escape Yumi Kazama

  • kazama yumi censoredcreampiebig titsMEYDtameike goroMEYD-646MEYD646meyd00646
    • 2021-01-11
    180 min

    Pacopacomama 011121_419 Natsuki Kikuta, Yurina Shiratori, Rie Masuko, Saori Hoshino, Manami Ueno

  • natsuki kikuta rie masuko uncensoredcreampiebig titspacopacomama
    • 2021-01-15
    331 min

    [YNPS-001]Quickly Picking Up Beautiful Bitches: Summer Pool Edition

  • censoredsquirtingbeautiful girlYNPSpetersnampaYNPS-001YNPS001h-021ynps00001
    • 2021-01-16
    74 min

    [MBF-005](A FANZA Exclusive) (For Streaming Editions) The Charlatan Couple - A Deceptive Woman And A Deceived Woman - Hibiki Otsuki Yui Hatano Chapter 2 A Perverted Couple Who Deceived My Neighbors And Fucked Them Both

  • otsuki sound yui hatano censoredcreampiebig titsMBFmax ak c takedaMBF-005MBF005mbf00005
    • 2021-01-22
    46 min

    [oretd-839]NAGASE

  • amateur censoredcreampieuniformoretdoretd-839oretd839oretd-839
    • 2021-01-23
    127 min

    [JUL-451]I Got Outed As A Cherry Boy By The Married Woman Next Door And Now I'll Do Whatever She Says. Ayaka Muto

  • ayaka muto censoredmature womanslutJULmadonnaunicorn fukudaJUL-451JUL451jul00451
    • 2021-01-31
    248 min

    [GAV-059]MILFs In Their Fifties - Raw Creampies

  • censoredcreampiemature womanGAVgogo adult videosGAV-059GAV059gav00059
    • 2021-02-12
    258 min

    [SKMJ-146]An Amateur Beautiful Girl Takes A Walk With A Remote-Controlled Vibrator Shoved Into Her Panties - SN Ward Edition - "I Can't Stand It Anymore ..." These Girls Are Trembling And Throbbing With Orgasmic Delight While Standing In

  • censoredblowjobmature womanSKMJblush girlyosukeSKMJ-146SKMJ146h-1324skmj00146
    • 2021-03-02
    70 min

    [IMPNO-031]A Nudist Cums To Tokyo Minori Tennen

  • natural minori censoredanalsingle workIMPNOimpactIMPNO-031IMPNO031h-1154impno00031
    • 2021-03-05
    80 min

    259LUXU-1393 A beautiful woman who works on the production of Luxury TV 1374 AI and who is just right for the word “talented” decides to appear on AV with the intention of releasing the desire to lose her place. She oozes her love juice in

  • amateur censoredamateurluxuluxu-1393luxu1393259luxu-1393
    • 2021-03-09
    62 min

    345SIMM-619 A busty wife who is chased by child-rearing exposes a nasty figure that her husband does not even know!

  • amateur censoredcreampiebig titssimmsimm-619simm619345simm-619
    • 2021-03-30
    56 min

    499NDH-011 Delivery is a part of daddy activity! ？？ The true identity of the fluffy beautiful girl with a naive atmosphere was a daddy active girl! Sales activities at the delivery destination! Azatoi Hanikami Take out the delivery-chan with the high

  • amateur censoredcreampieamateurndhndh-011ndh011499ndh-011
    • 2021-04-01
    121 min

    [HDKA-229]Naked Housewife Living In Setagaya Ward - Mayu Suzuki (26)

  • suzuki mayu censoredcreampiebig titsHDKAplanet plusdirector orafu shukoHDKA-229HDKA229h-237hdka00229
    • 2021-04-03
    139 min

    [PKPD-138]I Picked Up A Girl With F-Cup Tits Who I Found In The Office District And Fucked Her Raw Minami Haruhana

  • haruka minami censoredcreampiesingle workPKPDfuck group and fun friends daydreamersPKPD-138PKPD138pkpd00138
    • 2021-04-05
    66 min

    SIRO-4473 [First shot] [Swaying married woman’s soft milk] [Wife is dirty] Frustrated wife who has been married for 10 years is crazy about sex with other than her husband. She disturbs her big tits and greets her climax, she rides on a man .. A

  • amateur censoredbig titsmarried womansirosiro-4473siro4473siro-4473
    • 2021-04-21
    60 min

    FC2PPV 1780259 Relieve self-restraint and release stress for both men and women! Continuous vaginal cum shot!

  • amateur uncensoredfc2
    • 2021-04-22
    95 min

    [FUGA-048]Unforgettable Hot And Steamy Sex With My Mother's Friend Shino Inamoto

  • shino inamoto censoredcreampiemarried womanFUGAcenter villagesouthern earthparadise center villageFUGA-048FUGA048h-086fuga00048
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-04-30
    64 min

    FC2PPV 1795898 [2980 → Limited number of 1980] [Husband Barre last Gonzo] Local crunchy ex-Yang wife ❤️ Dirty little blowjob with remote control rotor ❤️ The most terrifying thick black abalone of 100 battles ❤️ Completely fallen 3 consecutive vagina

  • amateur uncensoredfc2
    • 2021-05-04
    93 min

    469G-642 Imadoki Girls’ Circle Exchange (Daddy Activity) Circumstances! Suzune

  • amateur censoredcreampieuniformgg-642g642469g-642
    • 2021-05-06
    73 min

    [REBD-552]Tsubaki 2 Southern Shangri La / Tsubaki Sannomiya

  • sannomiya tsubaki censoredsingle workREBDrebeccaherpes takaREBD-552REBD552h-346rebd00552
    • 2021-05-07
    123 min

    [KAM-083]I Brought The Married Woman Part-Timer Home From A Work Party, And Took Hidden Camera Voyeur Footage Of Our Fucks, Then Secretly Sold It As Porn 2

  • censoredcreampiebig titsKAMkarmamanji groupKAM-083KAM083kam00083
    • 2021-05-15
    121 min

    [SUJI-134]Breaking In A Pretty Y********l Barely Legals Love Getting Fucked By Persistent Older Men

  • censoredcreampiebeautiful girlSUJIkanranshaSUJI-134SUJI134suji00134
    • 2021-05-27
    98 min

    515BTGL-006 Azusa (20)

  • amateur censoredcreampieamateurbtglbtgl-006btgl006515btgl-006
    • 2021-07-23
    127 min

    [VEO-045]Appearing September, Makuhari Messe, Akihabara UDX, and many other Festival Events...Real Celebrity, Former Idol, AV DEBUT!! Misakura Ishikawa

  • misakura ishikawa censoredcreampiemature womanVEOvenuskaniebornVEO-045VEO045veo00045
    • 2021-07-24
    134 min

    [HUSR-239]Picking Up A Beautiful Y********l In Korea! "I Want To Have Sex..." One Month Of Pent Up Lust Is Ready To Explode! She Jumps At The Chance To Suck Cock!

  • censoredamateurHUSRbig morkalbooker thussleHUSR-239HUSR23957husr00239
    • 2021-07-31
    69 min

    ION-097 Rio

  • amateur censoredamateurionion-097ion097ion-097
    • 2021-08-02
    61 min

    FC2PPV 1944556 [Individual / Amateur] A 42-Year-Old Beautiful Wife Who Can’T Stop Having Sex With Her Brother-In-Law. Private Video That Betrays Her Husband And Has Her Young Body Seeded [Leaked, First Special Price]

  • amateur uncensoredfc2
    • 2021-08-06
    146 min

    [IPX-702]-KANZETSU- Developing The G-Spot! Limit-Breaking Extreme Orgasmic FUCKING!! Great Shower Of Squirt!! Rio Kuriyama

  • rio kuriyama censoredsquirtingblowjobIPXidea pocketmaeda no kahoritissueIPX-702IPX702ipx00702
    • 2021-08-13
    146 min

    [PPPD-948]They Might Come To Your City!？ The On Tour Massive Tits Soapland Girl"s JAV Debut! The No-Skin Creampie Special Riku haruka

  • haruka fragrant censoredcreampiebig titsPPPDoppaiPPPD-948PPPD948pppd00948
    • 2021-09-01
    45 min

    [090121-001][VR] Blowjob and riding sex in the bathroom

  • emi sakurai uncensoredcreampiehandjobcaribbeancom
    • 2021-09-17
    170 min

    [MVSD-481]Mazakon (Oedipus Complex). I Remember Getting My Nipples Played With And Fondled By An Older Guy For Days On End. Mai Kagari

  • flower hunting censoredcreampieschoolgirlMVSDm s video groupms video groupMVSD-481MVSD481mvsd00481
    • 2021-09-24
    141 min

    [JUL-713][VR] Rave Review ATTACKERS Titles - Special Selection Of 16 Titles, 640 Minutes. Long Scenes Only In This Best Of Collection.

  • ai kano kazama yumi censoredbig titslesbianJULmadonnamishima rokusaburoJUL-713JUL713jul00713
    • 2021-10-23
    241 min

    [SGSR-288]Really!？ AV - Shocking Situation That Actually Happened. She Witnesses A Crucial Moment! Step-mom Cheats On Her Husband With Her Step-son. Raw Fucking With Boss"s Daughter. Neighborhood Wife Stars In An AV. She Shows Off Hot Sex To Her

  • censoredcreampiebig titsSGSRbigmorkalsakaegyou chuushin sen kumiSGSR-288SGSR28857sgsr00288
    • 2021-10-29
    124 min

    [MIAA-523]"Mom"s New Husband Has It Out For Me" Mom Is Away All Week, And Now My Terrible Step-father Gives Me His Dick To Fuck For Squirting Orgasms And Pleasure. Mitsuki Hirose

  • mitsuki hirose censoredcreampiesquirtingMIAAmoodyzdoragon nishikawaminna no kikatanMIAA-523MIAA523miaa00523
    • 2021-11-18
    56 min

    230OREC-940 Miina (Miina Konno)

  • amateur censoredcreampieuniformorecorec-940orec940230orec-940
    • 2021-11-30
    240 min

    [RD-1088]A Special Featuring Sensual Mature Wives of the Showa Era. 6 Women, 4 Hours. "Ma"am, I"ll Make You Feel Good, Both in Front and Behind."

  • amateur censoredblowjobmature womanRDatena eizouRD-1088RD1088
    • 2021-12-11
    150 min

    [CHRV-146]A Maso Big Titty Migrant Worker! She"s Going To Pay Back Her Big Brother"s Debts With Her Emotionally Big Titties! This Little Sister Has Big Tits Worth More Than Just One Look! 113cm J-Cup Titties Ricchan

  • censoredcreampiebig titsCHRVcherries reboCHRV-146CHRV146chrv00146
    • 2021-12-16
    128 min

    [JURA-045]First Time Shooting A Married Woman, Again. Ayame Ushiozaki

  • ayame shiozaki censoredcreampiemarried womanJURAcenter villagejiro fukagawajurakuJURA-045JURA045h-086jura00045
    • 2021-12-17
    124 min

    [MVSD-492]Sorry. I Wet Myself. Aesthetic Oil Massage Makes Maiden"s Body Go Wild And Incontinent. Meisa Kawakita.

  • kawakita meisa censoredcreampiesquirtingMVSDm s video groupMVSD-492MVSD492mvsd00492
    • 2021-12-20
    59 min

    328HMDN-437 [Individual] H Cup Forty Slender Married Woman Too Beautiful Female President Personal Shooting That Goes Crazy For Raw Sex With A Salesman Leaving The Home (Nanao Nakano)

  • amateur censoredcreampiebig titshmdnhmdn-437hmdn437328hmdn-437
    • 2021-12-29
    66 min

    FC2PPV 2551687 [Personal Shooting] God Times !! ★ 18-Year-Old Still Orthodox Beautiful Girl Gonzo Attending A Private Lady School !!

  • amateur uncensoredfc2
    • 2021-12-30
    62 min

    Pacopacomama 123021_580 Fucking While Calling: Eat Shit For My Husband Sayaka Toda

  • amateur uncensoredpacopacomama
    • 2022-01-05
    120 min

    [NACR-492]Hold Me Tight... The Single Mother Who Fell In Love With Her Neighbor. Natsuki Takeuchi

  • natsuki takeuchi censoredcreampiesingle workNACRplanet plusdirector oshichi ku ryuuNACR-492NACR492h-237nacr00492



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored