high vision censored mini system jav




FC2ABWIPXEBODROYDDTTFSDSSDASDNATRHDKASSNISPRDSQTEMVSDHZGDGVHNACRNACXWAAAMIAAMIDV

2020-11-27
83 min

[SHMO-189]"I'll Get You Nice And Clean In The Bath, Baby... So Just Relax And Enjoy." A Special

  • censoredSHMOorustak softSHMO-189SHMO189
    • 2020-11-27
    302 min

    [MDTM-686]Secretly Busty Girls - 300 Min. SP

  • takarada monami pure white here censoredcreampiebig titsMDTMuchu kikakuMDTM-686MDTM686h-585mdtm00686
    • 2020-11-27
    206 min

    [KBI-047]A Beautiful Married Woman Gives The Ultimate Cherry Popping Fuck She'll Kindly And Gently Cherry Pop A Cherry Boy With Proper Instructions And Love!! Minami Shiratori

  • minami shiratori censoredbig titsmature womanKBIprestigemasarupansakanbiKBI-047KBI047118kbi00047
    • 2020-11-30
    42 min

    [ore-724]すずか

  • amateur censoredcreampieamateuroreore-724ore724ore-724
    • 2020-12-16
    17 min

    FC2PPV 1608118 [Virgin graduation! !! ] G cup Nana-chan’s latest appearance! !! A fan-participation project that gently brushes down Nana-chan’s fan virgin and makes her mass ejaculate

  • amateur uncensoredfc2
    • 2020-12-18
    84 min

    [FTHT-007](Nagoya Cutie Deep Throats Dick! Face Fucked Until She Screams And Spews!) She Begs To Suck Cock With Teary Eyes, And When She Cums The So Do The Slaps! She Swallows Rod All The Way To The Root, Drools, And Coughs But All It Does Is Make Th

  • censoredcreampiesquirtingFTHTfalenodavielfalenotubeFTHT-007FTHT0071ftht00007
    • 2020-12-26
    178 min

    [CLUB-624]A Stay-At-Home Wife Uses No-Bra Temptation To Have Sweaty Sex While Her Husband Is Away 4

  • censoredcreampiebig titsCLUBhentai shinshi clubCLUB-624CLUB624club00624
    • 2020-12-31
    228 min

    [HUNTA-921]Why Do I Keep Getting Horny For My Customers？! This Is Supposed To Be A Relaxation Salon, But I Can't Help Craving My Male Clients' Cocks...

  • censoredcreampieHUNTAhuntermorikihhh groupHUNTA-921HUNTA921hunta00921
    • 2021-01-19
    77 min

    200GANA-2410 Seriously Nampa, first shot. 1584 In Harajuku, catch a fish with a plan “I’ll give you 10,000 yen, so please buy what you like” ⇒ Get a girl whose friends are waiting late! When I heard the story, it seemed that the guard

  • amateur censoredamateurganagana-2410gana2410200gana-2410
    • 2021-01-30
    155 min

    [WAAA-032]She Came, Over And Over Again, When He Fucked Her With The Biggest Dick Of Her Life... Large Orgies With Black Cock Creampies *A Big Dick Power Fuck Fest* - An Abnormally Horny Wife Who Won't Be Satisfied With Her Husband's Tiny Dic

  • ayaka mochizuki censoredslutsingle workWAAAwanz factorywanzWAAA-032WAAA032waaa00032
    • 2021-02-09
    112 min

    241GAREA-498 Kotone

  • amateur censoredamateurbeautiful girlgareagarea-498garea498241garea-498
    • 2021-02-18
    58 min

    C0930 ki210218 Michiko Hirano 35years old

  • amateur uncensoredc0930
    • 2021-02-18
    240 min

    [HUNTA-953]"Are You Really Sure You Won't Regret Having Sex For The First Time With An Old Lady Like Me？" I Was A Cherry Boy, But When I Got My Cherry Popped, It Was With My Young And Pretty, Super Nice Big Tits Stepmom ... And That's

  • censoredcreampieblowjobHUNTAhuntervolvo nakanohhh groupHUNTA-953HUNTA953hunta00953
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-03-11
    182 min

    [SW-763]I Moved Into A Share House Of Big Titty Girls And I Was The Only Boy! Watching These Girls Walk Around With Their Tits Bursting Out Of Their Clothes Is Going To Make Me Explode!

  • censoredbig titsSWswitchcambridgeswitch switchSW-763SW7631sw00763
    • 2021-03-11
    49 min

    302GERK-359 R-san

  • amateur censoredcreampiemarried womangerkgerk-359gerk359302gerk-359
    • 2021-03-13
    150 min

    [MIDE-899]A Female Teacher Gets G*******g Fucked - Escalating Shame - Ibuki Aoi

  • aoi ibuki censoredsingle workMIDEmoodyzmametaro mamezawamoodyz divaMIDE-899MIDE899mide00899
    • 2021-03-15
    55 min

    FC2PPV 1688446 Active beauty member Yuko ❤️ Let’s change into bondage and everyone loves oil attack ❤️ Good condition Oma ○ When you screw a hot cheek ○ port into this, Yuko who rolls up while peeling white eyes Many purchase benefits

  • amateur uncensoredfc2
    • 2021-03-18
    134 min

    [ROYD-048]This Girl With Colossal Tits Suddenly Appeared At My Front Door, Wearing Only A Towel "I'm Sorry To Bother You ... But My Boyfriend Kicked Me Out Of The House ..." In Return For Helping Her Out, She Gave Me A Titty Fuck. And It

  • tomoko kamisaka censoredcreampiebig titsROYDroyalcognac kaminohhh groupROYD-048ROYD048royd00048
    • 2021-03-26
    121 min

    [VDD-171]The Stewardess Is In ... (The Coercion Suite) Aya Shiomi

  • aya shiomi censoredsquirtingdeepthroatVDDdream tickettakuanvivid dream ticketVDD-171VDD17124vdd00171
    • 2021-03-29
    70 min

    275OCHA-086 Ray Ray

  • amateur censoredamateurbeautiful girlochaocha-086ocha086275ocha-086
    • 2021-04-08
    210 min

    [ABW-078]【MGSだけのおまけ映像付き 20分】顔射の美学 14 美女の顔面に溜まりに溜まった白濁男汁をぶちまけろ！！ 蜜美杏

  • amateur censoredbig titsamateurabwabw-078abw078abw-078
    • 2021-04-15
    240 min

    [AQMB-024]Another Man's Wife Falling Into Adulterous Creampies

  • censoredcreampiemarried womanAQMBaquamall emanuelaqua mallAQMB-024AQMB024aqmb00024
    • 2021-05-01
    64 min

    324SRTD-0225 A Sober And Obscure Girl Compensated Dating! ？？ Insert raw Ji ○ port in swimsuit and vaginal cum shot

  • amateur censoredcreampieamateursrtdsrtd-0225srtd0225324srtd-0225
    • 2021-05-18
    57 min

    299EWDX-362 The wife of Binkan, who got married for a year, is so excited that she can eliminate her daily frustration!

  • amateur censoredcreampiemarried womanewdxewdx-362ewdx362299ewdx-362
    • 2021-05-21
    153 min

    [CJOD-298]"Adultery Is Our Culture!" Slutty Adultery Tales About Thick Nympho Wives With Erect Nipples Having Wild And Steamy Raw Sex With Men They've Picked Up Chitose Yuki

  • chitose in the evening censoredcreampiebig titsCJODchijo heavenkanoa tojoCJOD-298CJOD298cjod00298
    • 2021-06-05
    241 min

    [MMB-371]I Love Married Women With Big Asses! Wives Shake Their Big Asses Like Crazy 10 Women

  • kurata mao manami kudo censoredmature womanMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-371MMB371mmb00371
    • 2021-06-15
    43 min

    C0930 ki210615 Takako Nakao 30years old

  • amateur uncensoredc0930
    • 2021-06-19
    59 min

    HEYZO 2550 Toying With Sweaty Hot Chick! – Miyu Morita

  • miyu morita uncensoredcreampiehandjobheyzo
    • 2021-06-30
    65 min

    FC2PPV 1896545 [This is a miracle! ] God correspondence with a beautiful voice so that the complaint of the product disappears ♥♥ She met in real life She was a beautiful person after all ♥♥

  • amateur uncensoredfc2
    • 2021-07-02
    36 min

    520SSK-011 Rin

  • amateur censoredcreampieamateursskssk-011ssk011520ssk-011
    • 2021-07-02
    13 min

    FC2PPV 1898831 [Women until recently] 18-year-old Miyu-chan and her first experience train blowjob, slimy lotion raw fuck play in a naughty swimsuit!

  • amateur uncensoredfc2
    • 2021-07-15
    129 min

    [JRZE-062]First Time Filming My Affair. Nagisa Enomoto.

  • nagisa enomoto censoredcreampiemature womanJRZEcenter villageminatoyajurakuJRZE-062JRZE062h-086jrze00062
    • 2021-07-22
    153 min

    [WAAA-088]Getting Seduced And Fucked By My Sexy Female Boss Who Booked Us In The Same Hotel Room! I Came Inside Her 10 Times While Being Crushed By Her Huge Tits And Ass All Night... Mina Kitano

  • mina kitano censoredcreampiebig titsWAAAwanz factorywanzWAAA-088WAAA088waaa00088
    • 2021-07-23
    160 min

    [LULU-083]I Took Advantage Of The Gorgeous Madonna Who Peed Herself At The Class Reunion After Party And Made Her Into My Married Sex Pet! Runa Tsukino

  • tsukino luna censoredcreampiesingle workLULUlunaticsvagmanLULU-083LULU083lulu00083
    • 2021-08-02
    259 min

    [FAVKH-007]The Best Beautiful Married Women Have Their Porn Debut Kept Secret From Their Husbands 5 A Former Teacher, Manami Is Serious At First But Rolls Her Eyes Back During A Crazy 3P Fuck! The Next Girl Is A MILF Mixed Beauty Who Has Her First 3P

  • manami oura chihiro miyazaki censoredcreampiebig titsFAVKHarisebride in love dx ariseFAVKH-007FAVKH007h-1577favkh00007
    • 2021-08-13
    45 min

    480FRIN-045 "Personal Shooting" P Adult Scene Voyeur Of A Beautiful Female College Student. Sweaty Middle-Aged Ji ● Nasty Big Butt Who Devours Po Continuously Cum Straddling Raw Sex

  • amateur censoredcreampieamateurfrinfrin-045frin045480frin-045
    • 2021-08-17
    96 min

    261ARA-500 [Super Cute] [Super Big Tits] Riho-Chan Is Here! She Feels Cute At A Glance, "I Have Few Encounters And I’M Lonely …" She Applied To Satisfy Her Loneliness! [Puru Puru H Cup] If It’S Just This Big, It Will Shake No M

  • amateur censoredbig titsamateuraraara-500ara500261ara-500
    • 2021-08-20
    152 min

    [CAWD-261]"Hey, Who Do You Like？" 31 Days Of Immersive And Intense Creampie Fucking With Two Younger Step-Sisters Fighting Over Me... Yui Amane Mitsuki Nagisa

  • amane yui scooping censoredcreampiesquirtingCAWDkawaiiakai suiseiCAWD-261CAWD261cawd00261
    • 2021-08-21
    242 min

    [SUPA-592]Only Short Hair Wins!! The Ultimate 50 Beautiful Girls With Short Hair Over 4 Hours!!

  • censoredcreampieamateurSUPAs kyuu shiroutoSUPA-592SUPA592supa00592
    • 2021-09-25
    53 min

    FC2PPV 2247162 Sale Until 10/8! (No) [Lake Of Sperm With A Whip Smooth Thigh] Leg Footjob Health / Shooting Outflow / Sucking The Thighs Of An Unfussy Daughter With A Dick!

  • amateur uncensoredfc2
    • 2021-09-28
    15 min

    FC2PPV 2261092 [Individual] A Thirty Wife With A Child. As A Result Of Raising Her Forehead For Her Daughter, She Punctures And Is Vaginal Cum Shot By Another Stick And Disturbed.

  • amateur uncensoredfc2
    • 2021-11-16
    54 min

    230OREC-932 Rikachin (Tsubaki Rika)

  • amateur censoredcreampiebig titsorecorec-932orec932230orec-932
    • 2021-11-30
    66 min

    FC2PPV 2476404 For the first time, a beautiful woman dressed in a racy costume got anal without permission ♥♥

  • amateur uncensoredfc2
    • 2021-12-01
    120 min

    [AMBI-144]I Want To Do It With You!! Sexy Little Sister-In-Law Continues To Provoke Brother-In-Law Mitsuki Nagisa

  • scooping censoredcreampiebeautiful girlAMBIplanet plusbito sakuraanbibaresotsuAMBI-144AMBI144h-237ambi00144
    • 2021-12-02
    109 min

    [MILK-128]I Told This G-Cup Newlywed Lady Who Was About To Have Her Wedding That I Was Going To Give Her Some Special Treatment, And Instead Developed Her Sensual Abilities This Sensitive Big Tits Wife Was Lathered Up With Oil And Started To Feel Sup

  • future sena censoredcreampiebig titsMILKmilkMILK-128MILK128h-1240milk00128
    • 2021-12-29
    72 min

    FC2PPV 2550637 She’s Crazy While Saying "I Feel Guilty …" !! She Refused To Take A Gonzo At First, But At The End She Got A Vaginal Cum Shot And Lost Communication …

  • amateur uncensoredfc2
    • 2022-01-01
    46 min

    491TKWA-209 5 Koharu Hanasaki Put Out In This Daughter

  • amateur censoredcreampieuniformtkwatkwa-209tkwa209491tkwa-209
    • 2022-01-05
    61 min

    10musume 010522_01 I’ll Have A Special No Bra & T-Back Examination Today Nami Minami

  • amateur uncensored10musume
    • 2022-01-13
    83 min

    413INST-200 [Leaked] Gcup Active Gravure Idol (25) Cosplay Gonzo At A Hotel Secret Meeting With A Cameraman [Handling Precautions] (Mary Tachibana)

  • amateur censoredcreampiebig titsinstinst-200inst200413inst-200
    • 2022-01-31
    21 min

    FC2PPV 2637177 [Personal Shooting / Creampie] Pregnant Wife With Two Children, Between The Body Seeking Fertility And Pleasure …

  • amateur uncensoredfc2
    • 2022-02-04
    64 min

    230OREC-1004 Yu-San, 31 Years Old (Yu Hironaka)

  • amateur censoredcreampiemarried womanorecorec-1004orec1004230orec-1004
    • 2022-02-16
    72 min

    546EROF-022 [Model Leaked] Slender Busty Real 8 Head Gorgeous Beauty Actually, Half Crying With Unauthorized Vaginal Cum Shot To A Naive Tight-Fitting Maco (MIYABI)

  • amateur censoredcreampiebig titseroferof-022erof022546erof-022
    • 2022-02-26
    244 min

    [KTKY-062]THE Breast Milk Shooting Out - 4 Hours

  • censoredmarried womanamateurKTKYkittyx delusion tribeKTKY-062KTKY062ktky00062
    • 2022-03-04
    150 min

    [BBAN-366]The Journey Of Haru Yamaguchi And Sara Kagami

  • yoko yamaguchi kagami sara censoredBBANbibianBBAN-366BBAN366bban00366
    • 2022-03-18
    120 min

    [TPPN-221]The Squirting Goddess Yuzu Sumeragi Has Cum Down To Bless Us! An Orgasmic, Massive Squirting Splash! Sweaty, Orgasmic Sex!

  • emperor yuzu censoredcreampiebig titsTPPNteppanTPPN-221TPPN221tppn00221



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored