high vision censored slender javcensored housewife




FC2AUKSPPPDSTARSNACXABWNNPJCHRVADNWAAAAMBIMARAVENXMIAASQTECESDAVSAVEMASHKDGVHCAWD

2020-11-19
120 min

[OKSN-309]Adulterous Pleasure - She Might Be A Married Woman Now, But She's Still A Slut At Heart - Former Cum Dumpster Bumps Into An Old Flame For Passionate Creampie Sex

  • censoredOKSNabc mousouzokuokasan.comOKSN-309OKSN309oksn00309
    • 2020-11-16
    116 min

    [MXGS-1159]This Is A Video Record Of All The Fucking That Went On During The 2-And-A-Half Hours While Her Husband Was Out Of The House Himari Kinoshita

  • himari kinoshita himari hanazawa censoredbeautiful girlsingle workMXGSmaxingkeiha nobuyoMXGS-1159MXGS1159h-068mxgs01159
    • 2020-11-13
    156 min

    [IPX-570]A Beautiful Married Woman Became A Nude Model For The Sake Of Her Beloved Husband Shameful Pussy Juices, Dripping With Shame Airi Kijima

  • airi kijima censoredcreampiesingle workIPXidea pocketbungo maedadishIPX-570IPX570ipx00570
    • 2020-11-13
    125 min

    [DVAJ-483]My Sexual Relations With My Stepson Have Gone On For 3 Years, My Husband Is Being Suspicious. Even If I Try To Break Off The Relationship Now, My Teenage Stepson Won't Listen To Me, And Still Comes To Get My Body When My Husband Isn

  • kawakami nanami censoredmomsingle workDVAJalice japanhiromichi hoseDVAJ-483DVAJ483dvaj00483
    • 2020-11-12
    118 min

    [HAWA-229]This Amateur Wife Was Handed 1 Condom And Told To Go To The Home Of A Regular College S*****t And Spend The Night With Him, But There Was No Way She Could Be Satisfied With One Rubber-Covered Fuck, So She Let Him Have 2 Creampie Fucks And W

  • censoredbig titsHAWAcosmos eizomountain forestcosmospictures soft on demandHAWA-229HAWA2291hawa00229
    • 2020-11-07
    240 min

    [MMMB-036]An Old Lady With Short Hair! She's Got A Neckline That You'll Want To Suck And Slurp! 4 Hours

  • censoredcreampiebig titsMMMBmellow moonpig momMMMB-036MMMB036mmmb00036
    • 2020-11-06
    136 min

    [JUL-363]Tonight, I Might Be Able To Have My Cherry Boy Graduation. Kana Mito

  • kana mito censoredmature womansingle workJULmadonnajotaro tomiJUL-363JUL363jul00363
    • 2020-11-06
    74 min

    [MASE-008](For Streaming Editions Only) Fashionable Masks Seductive Raw Sex With A Mature Woman Are Beauty-Conscious Old Ladies Also Highly Sexual Too!？ Raw Sex With Beautiful Mature Woman Babes Only Hibiki

  • censoredcreampieblowjobMASEcrystal eizotakeshi matsudairamadam maniac plusMASE-008MASE00849mase00008
    • 2020-11-06
    119 min

    [JUL-365]Swimming Class NTR Amazed By The Instructor's Kindness, This Married Woman's Shocking Cheating Video! Himari Kinoshita

  • himari kinoshita censoredmature womansingle workJULmadonnarokusaburo mishimaJUL-365JUL365jul00365
    • 2020-11-01
    116 min

    [HDKA-220]Naked Housewife: Honoka Tsuji, Living In Adachi Ward (27)

  • tsujii honoka censoredcreampiebig titsHDKAplanet plusdirector orafu shukoHDKA-220HDKA220h-237hdka00220
    • 2020-11-01
    120 min

    [NACR-368]Tempted By The Director's Wife - Natsuki Takeuchi

  • natsuki takeuchi censoredblowjobslutNACRplanet plusbito sakurananakuruNACR-368NACR368h-237nacr00368
    • 2020-11-01
    120 min

    [AUKG-498]Married Woman Lesbian Adultery Toko Namiki Ruri Maisaki

  • namiki touko mai sakiri censoredlesbiandramaAUKGu krentoAUKG-498AUKG498aukg00498
    • 2020-11-01
    120 min

    [NACR-363]I'm Crazy About My Brother-in-law, Who Is Stronger Than My Husband - Kanon Nakajo

  • nakajo canon censoredcreampieblowjobNACRplanet plusbito sakurananakuruNACR-363NACR363h-237nacr00363
    • 2020-10-24
    117 min

    [JUL-348]A Former International Airlines Cabin Attendant Is Getting Signed Exclusively To The Madonna Label #2!! After Having Babymaking Sex With Her Husband, She Always Gets Creampie Fucked By Her Father-In-Law... Jun Harumi

  • jun shunmei censoredcreampiemature womanJULmadonnajotaro tomiJUL-348JUL348jul00348
    • 2020-10-23
    120 min

    [NEM-046]Unnatural Sex 50-Something With Not Her Son The Mother Who Was Loved By Her 50-Something Husband And The Cock Of The Other Man Of The House Tsubaki Amano

  • amano tsubaki censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-046NEM046143nem00046
    • 2020-10-23
    240 min

    [GIGL-624]Married Nurses Get Slutty At Midnight 2 - Hospital Adultery On The Night Shift 12 Girls, 4 Hours

  • censoreduniformnurseGIGLgigolo gigologigoloGIGL-624GIGL624h-860gigl00624
    • 2020-10-18
    103 min

    [VEC-448]"Hey, Could You Stay With Me A Little Longer？" We Missed The Last Train Home... So I Spent The Night With My Usually Strict Boss, Sweaty Squirting Sex Mio Kimijima

  • kimishima mio censoredcreampiebig titsVECvenusbingo tamatsukamegami venusVEC-448VEC448vec00448
    • 2020-10-10
    163 min

    [EYAN-159]"I Can Tell My Mouth Feels Great" This Horny Slut Loves To Lick Cock! Total Blowjob Addict - The More She Sucks, The Wetter She Gets! She Loves Fellatio More Than She Does Sex! Hot Horny Young Wife's Porn Debut Moe Aisu

  • aisu moe censoredbig titsblowjobEYANe bodykyoseiwives of hanasagariEYAN-159EYAN159eyan00159
    • 2020-10-10
    133 min

    [MEYD-627]While My Husband Takes A 5 Minute Smoke Break, My Father-In-Law Gives Me A Pregnancy Fetish Creampie Quickie, 10 Times A Day... Rei Kuruki

  • satoshi kuruki censoredcreampiesingle workMEYDtameike gororokusaburo mishimaMEYD-627MEYD627meyd00627
    • 2020-10-03
    116 min

    [JUL-338]I Went Home To Visit My Family For 3 Days, And I Spent The Entire Time Making Love With My C***dhood Friend's Mother, Whom I Had Always Loved, And We Completely Forgot The Time, But We Have This Video Record Of Our Time Together. Maki Ho

  • hojo asahi censoredcreampiemature womanJULmadonnajo asagiriJUL-338JUL338jul00338
    • 2020-10-03
    120 min

    [JUL-339]I Became Fascinated By The Big Dick Of My Daughter's Cherry Boy Boyfriend... Rumi Mochizuki

  • rumi mochizuki censoredmature womansingle workJULmadonnabieber gonzoJUL-339JUL339jul00339
    • 2020-10-01
    121 min

    [NACR-358]Husband's Brother And NTR Domestic Adultery Hikari Sena

  • hikari sena censoredcreampiebig titsNACRplanet plussakura ninshichi ku ryuuNACR-358NACR358h-237nacr00358
    • 2020-10-01
    123 min

    [NACR-355]Untidy Bride: Kaori Iiyama

  • kaori iiyama censoredcreampieblowjobNACRplanet plussakura ninshichi ku ryuuNACR-355NACR355h-237nacr00355
    • 2020-09-26
    123 min

    [MIAA-321]I Accidentally Dropped My Sexiest Lingerie Onto The Balcony Below - Naughty Neighbor Gets The Wrong Idea And Ends Up Banging A Busty MILF All Night Long Mio Kimijima

  • kimishima mio censoredcreampiebig titsMIAAmoodyzham the mceveryone s porn starMIAA-321MIAA321miaa00321
    • 2020-09-26
    118 min

    [MIDE-830]Young Wife Can't Get Her Husband To Fuck Her... She Doesn't Want To Live Like A Nun And In Her Desperation Gives In To Her Father-In-Law's Probing Tongue All Over Her Shivering Flesh, His Cock In Her Holes

  • mizuki ai censoredsquirtingsingle workMIDEmoodyzdragon nishikawamoodyz divaMIDE-830MIDE830mide00830
    • 2020-09-25
    145 min

    [BANK-015]Meet A Normal-Looking, Adorable Housewife Who Looks Like The Kind Of Lady Who Lives In The Neighborhood Of The Creampie Outdoor Hot Spring Resort! She Looks Like A Plain Jane, But This Beautiful And Innocent Lady With A Slender Body Has Hug

  • censoredcreampieBANKpussy banktake chanBANK-015BANK015h-1495bank00015
    • 2020-09-21
    138 min

    [AGAV-034]Amazing Tits - Slender H-Cup Amateur New Wife Has An Adulterous Orgasmic Fuck With Loads Of Squirting And Saliva - Hikari Sena

  • hikari sena censoredcreampiebig titsAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-034AGAV034agav00034
    • 2020-09-20
    118 min

    [OBA-407]My Husband Won't Have Me... Satomi Fueki

  • satomi fueki censoredmature womanslutOBAmadonnarokusaburo mishimaobasanOBA-407OBA407oba00407
    • 2020-09-20
    118 min

    [JUL-320]Hard And Tight Sex - An Illicit Relationship With My Father-In-Law That Started With Some Family Troubles - Shion Sato

  • sato white sound censoredbig titsmature womanJULmadonnarokusaburo mishimaJUL-320JUL320jul00320
    • 2020-09-20
    148 min

    [URE-058]A Madonna Exclusive Airi Kijima In Her First Ripe Comic!! Original Story/Iris Art The Day Natsumi Sasaki's Womb Was Defiled With Orgasmic Pleasure

  • airi kijima censoredmature womansingle workUREmadonnakitorune kawaguchiure.comiURE-058URE058ure00058
    • 2020-09-18
    123 min

    [VEC-442]I Was Targeted By My Wife's Girlfriend And I Couldn't Refuse A Vaginal Cumshot - Yuka Mizuno

  • yuka mizuno censoredcreampiemature womanVECvenussarumegami venusVEC-442VEC442vec00442
    • 2020-09-18
    113 min

    [VENU-964]"Hold On For 10 More Minutes!" Her Raw Pussy Felt So Good, My Cherry Boy Cock Was About To Burst As I Pounded Her With Ass-Shaking Thrusts, But This Horny Mama Was Controlling My Ejaculations - We Took A One-Day Hot Spring Vacation

  • kana morisawa kanako iioka censoredcreampiemature womanVENUvenussarufakecest winntersVENU-964VENU964venu00964
    • 2020-09-13
    124 min

    [KIMU-012]This Blonde Housewife Has A Bushy Cunt Down There And She's Luring Horny And Gentle Young Men For Creampie Sex & Cum Face Semen Splatters And Middle-Aged Cherry Boy Cherry Popping Sex. A Maso Young Wife Who Loses Herself In Deep And

  • star ameri censoredbeautiful girlsingle workKIMUavs collector shiroyukifresh babe avs collector sKIMU-012KIMU012kimu00012
    • 2020-09-12
    120 min

    [IPX-539]On The Night Of Our Class Reunion, Because Of A Sudden Rainstorm I Missed My Last Train Home, And I Had To Spend the Night At A Hotel With A Loser... Nanami Misaki

  • nanami misaki censoredcreampiesingle workIPXidea pocketxavier thomas 2dishIPX-539IPX539ipx00539
    • 2020-09-05
    118 min

    [JUL-308]A Married Woman Who Broke The Rules Of Cuckold Sex - One By One, She Accumulated Crimes And Lies Against Her Husband - Maki Hojo

  • hojo asahi censoredmature womansingle workJULmadonnashiro shotenJUL-308JUL308jul00308
    • 2020-09-05
    159 min

    [JUL-303]This Late-Blooming Married Woman Is Blossoming Like Crazy A Former Stage Actress Married Woman Tsubaki Yukino 30 Years Old Her Adult Video Debut!!

  • yukino tsubaki censoredmature womansingle workJULmadonnahimu lockJUL-303JUL303jul00303
    • 2020-09-05
    119 min

    [JUL-309]With Only 1 Month To Go Until The End Of The World, I Decided To Fuck My Long-Lost Love From My S*****t Days Until My Husband With Whom I Spent Many Years Together... Rei Kuruki

  • satoshi kuruki censoredmature womansingle workJULmadonnamametaro mamezawaJUL-309JUL309jul00309
    • 2020-09-05
    120 min

    [JUL-314]I Left My Lady-Loving Dad With My Pushover Wife, And Went On A 3-Day, 2-Night Business Trip... Sara Kagami

  • kagami sara censoredmature womansingle workJULmadonnamametaro mamezawaJUL-314JUL314jul00314
    • 2020-09-05
    119 min

    [JUL-310]My New Stepmom - My Favorite Woman Is Now My Stepmom - Yumi Sakurai

  • yumi sakurai censoredmature womansingle workJULmadonnajyoji kawaiJUL-310JUL310jul00310
    • 2020-09-05
    146 min

    [JUL-301]The Year, 2020, Summer, Shocking. This Married Woman Is A Former TV Commercial Actress Hiroka Suzuno 36 Years Old Her Adult Video Debut!!

  • hiroka suzuno censoredmature womansingle workJULmadonnamametaro mamezawaJUL-301JUL301jul00301
    • 2020-08-30
    133 min

    [LULU-035]This Pushover Married Woman Who Lives In The Same Apartment Building Has An Older Sister With A Big Ass Who Isn't Aware Of How She's Luring Me To Temptation In Her Tight One Piece Dress, And One Day, I Could No Longer Resist, So I S

  • himari kinoshita censoredcreampiesingle workLULUlunaticsluminaxLULU-035LULU035lulu00035
    • 2020-08-28
    98 min

    [YST-226]Coworker's Wife Is A Private Cum Dumpster For 3 Days, Tsukasa Nagano

  • tsukasa nagano censoredcreampiedeepthroatYSTkomyoYST-226YST226540yst00226
    • 2020-08-28
    120 min

    [NEM-042]Genuine Abnormal Sex A Fifty-Something Stepmother And Her Stepson Chapter Sixteen A Stepmom Is Pleasured By Her Stepson's Thick Jellyroll Misato Shibasaki

  • misato shibasaki censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-042NEM042143nem00042
    • 2020-08-27
    171 min

    [HAWA-221]A Cuckold Investigation "I Want To Record My Beautiful Naked Body For Posterity" When She Participated In A Memorial Real Nude Photo Session With A Young Model With A Big Cock, She Began To Drool With Lust And Forgot All About Her H

  • censoredHAWAcosmos eizomountain forestcosmospictures soft on demandHAWA-221HAWA2211hawa00221
    • 2020-08-22
    117 min

    [JUL-291]I Lost My Mind After 7 Days Of Being Fucked By My Husband's Boss... Airi Kijima

  • airi kijima censoredmature womansingle workJULmadonnatakeshi kogaJUL-291JUL291jul00291
    • 2020-08-22
    119 min

    [JUL-293]Married Office Lady's Total Domain: Slender Married Woman Shamefully Does What She's Told At The Office - Natsuki Takeuchi

  • natsuki takeuchi censoredmature womansingle workJULmadonnajotaro tomiJUL-293JUL293jul00293
    • 2020-08-16
    102 min

    [VEC-436]Sweaty And Soaked In Lust! I Was Captured By An Escaped Convict Old Lady And Compelled To Creampie Her Yuka Mizuno

  • yuka mizuno censoredcreampiemature womanVECvenusbingo tamatsukamegami venusVEC-436VEC436vec00436
    • 2020-08-16
    120 min

    [KSBJ-093]A Slender Wife Who Fell For The Trap Laid By Her Cuckold Fantasies-Obsessed Husband And His Little Brother Ayaka Muto

  • ayaka muto censoredblowjobmature womanKSBJksb kikaku emmanuellebito sakuraKSBJ-093KSBJ093ksbj00093
    • 2020-08-14
    142 min

    [SKMJ-116]3rd Year Of Marriage Slender Healthy Hottie, Chika Aisaka

  • chinatsu osaka censoredlingeriesingle workSKMJred face girlone topSKMJ-116SKMJ116h-1324skmj00116
    • 2020-08-08
    118 min

    [MEYD-612]My Father, Who Is Still Sexually Active With My Mom, Felt Lust For My Wife And Gave Her A Creampie On Her Ovulation Day - Natsuki Takeuchi

  • natsuki takeuchi censoredcreampieslutMEYDtameike goroasagiri jouMEYD-612MEYD612meyd00612
    • 2020-08-08
    120 min

    [DASD-710]A Doe-Eyed Natural Airhead Elder Sister Type Married Woman Who Was Unknowingly Luring Men To Temptation Is Unable To Say No When Asked Amy Fukada

  • emi fukada censoredcreampiesingle workDASDdasmishima rokusaburoDASD-710DASD710dasd00710
    • 2020-08-01
    230 min

    [ZMAR-021]She's Baring It All! Yuka Honjo

  • yuka honjo censoredcreampiemature womanZMARplanet plusthe whole damn thingZMAR-021ZMAR021h-237zmar00021
    • 2020-08-01
    117 min

    [JUL-251]The Condoms My Wife Buys Are One Size Too Big - Eimi Fukada

  • emi fukada censoredmature womansingle workJULmadonnajotaro tomiJUL-251JUL251jul00251
    • 2020-08-01
    119 min

    [JUL-288]My Beloved Wive Is Currently Interviewing For Her First Adulterous Sex Partner - Miho Tono

  • miho tsuno censoredmature womansingle workJULmadonnajotaro tomiJUL-288JUL288jul00288
    • 2020-07-24
    101 min

    [YSN-519]I Get Fucked By My Horny Father-In-Law All Day And All Night - Tukasa Nagano

  • tsukasa nagano censoredcreampiesingle workYSNnonYSN-519YSN519h-127ysn00519
    • 2020-07-24
    120 min

    [NEM-040]True Strange Desires Stepmom In Her 40s And Stepson No.12 Proud Masochist Stepmom Breaking In Her Stepson Shoko Ueki

  • shoko ueki censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-040NEM040143nem00040



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored