high vision deepthroat nasty hard javcensored jav




FC2ABWONEZSANMIAAVENUSTARSGMEMHNDNNPJRBDSHKDAWDCHRVSSISHMNMIDESQTEDASDAVSAMEYD

2020-10-22
93 min

[OKS-098]Wet And Shiny, Perfectly Fitting Godlike Swim Suit: Horikita Tsumugi. Enjoy These Cute S*********ls' Swimsuits! This AV Starts With A Voyeur View Into A Changing Rom, And Ends With Close-ups Of Fetishes Such as Shaved Pussies, Hair Stick

  • horikita tsumugi censoredbeautiful girlsingle workOKSdaddy s private photosgoddess in a school swimsuitOKS-098OKS0981oks00098
    • 2020-10-23
    75 min

    259LUXU-1329 Luxury TV 1317 Former model half-beautiful woman reappears with frustration! ？？ Caress that stimulates the whole body from a violent kiss! A lewd blowjob to play with other sticks! Cowgirl with a fierce waist! Show off to your boyfriend

  • amateur censoredamateurluxuluxu-1329luxu1329259luxu-1329
    • 2020-10-24
    118 min

    [JUL-356]Before The Wife Next Door Comes Home... Mio Kimishima

  • kimishima mio censoredbig titsmature womanJULmadonnaamazing meatJUL-356JUL356jul00356
    • 2020-10-27
    121 min

    [KNAM-025]Complete Raw Style @sora #neatandcleancollegegirls #cute #firsttimeglory #crazyvaginacum #halfinhalfout #hugeloads - Shi Nakata, Sora Inoue

  • sora inoue censoredcreampiesingle workKNAMfirst star100 raw styleKNAM-025KNAM025h-491knam00025
    • 2020-11-06
    227 min

    [DOCP-256]This Hostess Princess Had Such Soft Big Tits That Were Practically Spilling Out Of Her Shirt That They Were Positively Stimulating, And When She Noticed Me Staring At Them, She Smiled Sweetly, With Hungry Lust In Her Eyes... 2

  • censoredbig titsDOCPprestigedoc premiumDOCP-256DOCP256118docp00256
    • 2020-11-12
    114 min

    [HONB-195]My Big Titted Friend Has Big Tits - Hadzuki & Kisaragi

  • censoredbig titsHONBmercurythe first shibuya special f e headquarHONB-195HONB195h-1133honb00195
    • 2020-11-14
    39 min

    FC2PPV 1570076 Additional content Special price ❤️ Immersive GoPRo video and high-quality iPhone video ❤️ I want to be a sex DOLL for you ❤️ Purchase privilege available

  • amateur uncensoredfc2
    • 2020-11-27
    120 min

    [NEM-048]New Kinky Sex 2 - MILF In Her Fifties Craves Her Stepson's Cock Iku Kondo

  • satoshi kondo satomi kondo censoredbig titsmature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-048NEM048143nem00048
    • 2020-11-27
    231 min

    [SIM-099]"Huh, Is She Luring Me To Temptation!？" This Big Tits Sister-In-Law's Temptation Is Amazing! I Could Never Tell My Big Bro About This LOL I Got My Brains Fucked Out By My Sister-In-Law...

  • censoredcreampiebig titsSIMprestigeamateur pussiesSIM-099SIM099118sim00099
    • 2020-11-29
    132 min

    [NKD-266]Koichi Takahashi's Adulterous Secret Meeting With A Married Woman 2

  • censoredamateurmature womanNKDnakajima kogyokoichi takahashiNKD-266NKD266nkd00266
    • 2020-12-03
    119 min

    [EKDV-651]From The Moment Our Eyes Met She Wanted Me. All Alone With A Slender Babe With A Beautiful Booty. Ichika Matsumoto

  • ichika matsumoto censoredcreampiebeautiful girlEKDVcrystal eizoharuo miyafujie kissEKDV-651EKDV65149ekdv00651
    • 2020-12-05
    55 min

    FC2PPV 1595595 Iki rolled up with invisibility China ♥ Suki Munmun older sister, surprisingly I was a sensitive girl who rolled up w Immediately Iki in 5 seconds after insertion ♪ * High quality version & review benefits included ♪

  • amateur uncensoredfc2
    • 2020-12-10
    61 min

    1Pondo 121020_001 Sweet kiss and Fucking: Chisato Takayama

  • amateur uncensored1pondo
    • 2020-12-12
    89 min

    [HONB-198]A Gal Working At The Prefectural Commercial Department "I'm Dropping Out Next Month"

  • censoredamateurHONBmercurythe first shibuya special f e headquarHONB-198HONB198h-1133honb00198
    • 2020-12-18
    156 min

    [BDA-130]Night Breeding - Wide Open Slit Mitsuki Nagisa

  • scooping censoredbdsmsingle workBDAbermuda mousouzokuichikan abashiriBDA-130BDA130bda00130
    • 2020-12-23
    91 min

    [SDHS-017]Horny Sluts Satisfy Themselves With The Creampie Dildo Of Their Dreams

  • iori furukawa masami ichikawa censoredbeautiful girlSDHSsod createSDHS-017SDHS0171sdhs00017
    • 2020-12-26
    119 min

    [MIAA-368]When I Went Home To The Country To Visit My Folks, My G-Cup Titty C***dhood Friend Came Over To Spend The Night, For The First Time In 10 Years, And She Was So Innocent And Not Wearing A Bra, So I Gave Her 10 Creampie Fucks. Nene Tanaka

  • nene tanaka censoredcreampiebig titsMIAAmoodyzcontour styleeveryone s porn starMIAA-368MIAA368miaa00368
    • 2020-12-27
    159 min

    [AUKS-121]Shemale Lesbian -Kinky Slender Babe & Wild Clit-Dick Cutie- Kana Sayuki Kanna Uno

  • sanayuki kana uno sakina abe sakina censoredanallesbianAUKSu krentoAUKS-121AUKS121auks00121
    • 2021-01-20
    120 min

    [VNDS-5208]Horny MILFs Masturbate In Their Work Clothes

  • yoshiko tozawa nakamoto mika censoreduniformmature womanVNDSstar paradisenext toilet r eVNDS-5208VNDS5208h-254vnds05208
    • 2021-02-11
    95 min

    418YSS-081 Hikaru

  • amateur censoredamateurcosplayyssyss-081yss081yss-081
    • 2021-02-12
    147 min

    [GNAB-047]JKs Who Wear Black Stockings Only! When We Told These Ladies That They Would Win Big Cash Money Prizes If They Could Identify The Remote Control That Was Controlling The Remote-Controlled Vibrator Tickling Their Pussies ...

  • censoredschoolgirlGNABprestigebang prestigeGNAB-047GNAB047118gnab00047
    • 2021-02-16
    483 min

    [STARS-333]Nanase Asahina 's SOD Star Graduation. Endless Hard Drilling Non-Stop Pounding All Facials 15-Load Special!

  • asahina nanase censoredsquirtingbeautiful girlSTARSsod createafro takahashisod starSTARS-333STARS3331stars00333
    • 2021-02-22
    129 min

    [OPPW-086]I'm An Evolutionary Man Who Transformed Into A Girl, And Now I'm Better At Squirting Than Ejaculating Ai Sato

  • airi sato censoredsquirtingsingle workOPPWopenipeni world mousouzokukamon seijoiOPPW-086OPPW086oppw00086
    • 2021-02-27
    118 min

    [MIMK-085]Having Sex With My Super Capable Married Female Coworker On Our Business Trip! She's Always Really Serious And Scary But This Time She's Just A Woman - JULIA

  • julia censoredcreampiebig titsMIMKmoodyzkitorune kawaguchimankitsuMIMK-085MIMK085mimk00085
    • 2021-03-07
    137 min

    [URKK-037]Every Day, The Perverted Landlord From Next Door Is Fondling My Titties And Fucking My Brains Out Miku Maina

  • maina miku censoredcreampiebig titsURKKunfinishedrolanda familiar breastURKK-037URKK037urkk00037
    • 2021-03-07
    75 min

    345SIMM-617 THE Takamine Flower! A divine beautiful girl who reigns at the top of the school caste appears here! !! !! The transparent and beautiful BODY & the idol face that grabs the hearts of boys are disturbed and hope for pregnancy! ？？ The f

  • amateur censoredcreampieuniformsimmsimm-617simm617345simm-617
    • 2021-03-13
    116 min

    [DPMI-057]Wonderful Queen REMI

  • remi censoredsingle workDPMImiludopamixDPMI-057DPMI057dpmi00057
    • 2021-03-21
    119 min

    [DASD-834]Married Woman Seduced With Aphrodisiacs Pretends To Resist But Soon Becomes A Kinky Slut Hibiki Otsuki Rin Kira

  • otsuki sound kira rin censoredcreampiedramaDASDdasrokusaburo mishimaDASD-834DASD834dasd00834
    • 2021-03-30
    54 min

    292MY-439 Miyuki Nitta

  • amateur censoredcreampiebig titsmymy-439my439292my-439
    • 2021-04-22
    29 min

    FC2PPV 1782413 * Resale until weekend [Individual] Please see after understanding.

  • amateur uncensoredfc2
    • 2021-04-26
    78 min

    FC2PPV 1765188 Former subordinate Nao (Nao) ❤️ Squid with 3 points of blame of chestnut electric massage machine, thick vibe and anal vibe ❤️ Please pay attention to the volume. There is a purchase privilege

  • amateur uncensoredfc2
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-14
    120 min

    [BLK-496]We Got Our Hands On An Excessively Erotic Personal Trainer With A Voluptuous, Explosive Ass Who Will Pound You With Cowgirl Sex! - That Night, I Was Fucked With Ass-Training Sex Until My Semen Tank Hit Rock Bottom -

  • censoredcreampieslutBLKkira kirakira kira black galBLK-496BLK496blk00496
    • 2021-05-25
    34 min

    FC2PPV 1835807 [No] Limited time !! Super neat !! Super beautiful and super beautiful legs Nagusho wet shaved nursery teacher inserts rich continuous raw (Part 2)

  • amateur uncensoredfc2
    • 2021-06-04
    172 min

    [JUL-593]365 Days Of Estrus The Bunny Wife With The Strongest Sex Drive In The Animal Kingdom Iori Takahira 30 Years Old Porn Debut

  • high ratio good cage censoredmature womansingle workJULmadonnamametaro mamezawaJUL-593JUL593jul00593
    • 2021-06-19
    72 min

    418YSS-83 Aoi

  • amateur censoredbig titsamateuryssyss-83yss83418yss-83
    • 2021-06-25
    54 min

    FC2PPV 1888200 [Personal shooting] Immature beautiful young wife and affair Enko! Excited by the female genitals of bristles and vaginal cum shot [Amateur Gonzo]

  • amateur uncensoredfc2
    • 2021-07-02
    36 min

    520SSK-011 Rin

  • amateur censoredcreampieamateursskssk-011ssk011520ssk-011
    • 2021-07-02
    120 min

    [PRED-323]When My Wife Isn't Around I Secretly Sneak In A Quickie With My Nympho Sister-in-Law With Huge Tits... JULIA

  • julia censoredcreampiebig titsPREDpremiumtrendy yamaguchielegancePRED-323PRED323pred00323
    • 2021-07-17
    119 min

    [JUL-657]The Conversion of a Married Woman. Momoko Isshiki.

  • momoko isshiki censoredmature womansingle workJULmadonnajyoji kawaiJUL-657JUL657jul00657
    • 2021-07-22
    240 min

    [BMW-238]Continuing Fucking Her After Creampie! 50 Shots Of Pregnancy-assured Sex Into a Creampie Shake.

  • julia bud censoredcreampiebeautiful girlBMWones factorywanzBMW-238BMW238bmw00238
    • 2021-07-30
    98 min

    [EKW-072]Nipple Pleasure Connoisseur. Himari Kinoshita

  • himari kinoshita himari hanazawa censoredblowjobslutEKWwaap entertainmentk westcobraEKW-072EKW0722ekw00072
    • 2021-08-09
    80 min

    FC2PPV 1975743 Bristle Slender Kotoha Is 18 Years Old. The Bristle Man Hair Is Innocent In The Outstanding Style Of The Slender Body. Although She Is Ashamed Of The Pleasure Of An Adult Cock, Her Pant Voice Does Not Stop And A Large Amount Of Vaginal

  • amateur uncensoredfc2
    • 2021-08-12
    93 min

    [OKP-089]Miho Tomi Soft Fluffy Tits That Will Drive You Mad!! Godlike Huge Marshmallow Titties A Gift From Heaven, She Puts On Things Like A School Swimsuit, Gym Shorts, And A Micro Bikini, On Her Cute Thick Body, And We See Close Up Shots Of Her Ama

  • miho tomii censoredbig titssingle workOKPoyaji no kosatsukouenji gorokami pantyhoseOKP-089OKP0891okp00089
    • 2021-08-14
    175 min

    [KAGP-193]Amateur Girl Is Actually Amazing At Blowjobs, 10 Modern Amateurs Met Online, 180 Minutes

  • censoredamateurblowjobKAGPkaguya hime pt mousozokutsumatori no okinakaguya hime ptKAGP-193KAGP193kagp00193
    • 2021-08-21
    243 min

    [GIGL-657]Alone In The Mixed Hot Spring...Hot And Steamy Kissing And Sex Between A Step Mother And Step Son 2

  • censoredcreampiemature womanGIGLgigolo jigoronagasawa jungigoloGIGL-657GIGL657gigl00657
    • 2021-09-02
    48 min

    481SACZ-074 Nana 3

  • amateur censoredmarried womanamateursaczsacz-074sacz074481sacz-074
    • 2021-09-03
    122 min

    [ADN-344]The Story Of How The Woman I Hired Gave Me A Super Erotic Blowjob Iroha Natsume

  • natsume saiharu censoredblowjobsingle workADNattackersdoragon nishikawaotona no dramaADN-344ADN344adn00344
    • 2021-09-03
    119 min

    [CAWD-271]Flirty Colleague With Big Boobs And Her Boss Go On A Fucking Frenzy In A Hotel Misono Mizuhara

  • suwon miso censoredbig titssingle workCAWDkawaiinikusonCAWD-271CAWD271cawd00271
    • 2021-09-23
    113 min

    [IENF-167]You"ll Be Able To Clearly See Everything, Even Down To The Number Of Anal Wrinkles On Her Ass! No Mosaic Censoring A Consecutive Orgasmic Anal Masturbation Show-Off 4

  • miyazaki rin jinno hina censoredanalIENFie nergyienfIENF-167IENF1671ienf00167
    • 2021-10-02
    250 min

    [YMDD-244]Debut While Watching A Shooting -Their Pussies Gets Wet From Others Fucking, And They Can"t Take It-

  • hotaru mori censoredcreampiebig titsYMDDmomotaro video publishinghimrockyoung peachYMDD-244YMDD244ymdd00244
    • 2021-10-14
    58 min

    285ENDX-365 Aza And Erotic And Bitch Cute Waist Goddess

  • amateur censoredcreampieamateurendxendx-365endx365285endx-365
    • 2021-10-21
    244 min

    [NHDTB-594]The BEST of the Enema Pervert. A Sensitive Girl Who Sprays Like Crazy and Makes Resounding Ass Sounds After Getting Injected with an Enema, 12 Girls + The Filming of a New Work.

  • censoredcreampieNHDTBnatural highNHDTB-594NHDTB5941nhdtb00594
    • 2021-11-05
    149 min

    [JUL-759]With A Cool Face, My Underwear Are Always Sopping Wet. Rie Suimitsu, 27 Years Old AV DEBUT

  • water honey rie censoredmature womansingle workJULmadonnamamezawa mametarouJUL-759JUL759jul00759
    • 2021-11-11
    125 min

    [STARS-464]運命を絶頂で変えろ!大好きな彼に告白するため学生時代にタイムリープしたのに同級生とSEXしてしまう流されやすい私。 古川いおり

  • kogawa iori censoredSTARSsod createtaiga kosakaisod starSTARS-464STARS464
    • 2021-12-06
    43 min

    FC2PPV 2493025 [Personal Shooting] Mr. Ol Who Was Very Good At The Previous Father’s Cock, Cum Shot And Vaginal Cum Shot

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored