high vision housewife jav creampie hours more




FC2CHRVVEMASQTESHKDSTARSGVHHNDNNPJVENUBLKSSNIMEYDSDABNACXROYDMILKNACRHUNTBSANNGOD

2020-11-06
116 min

[JUL-360]Madonna Exclusive #2! Creampie Ban Lifted! Step-mom And Step-son Go Crazy Due To A Heatwave, For Sweaty Creampie Homecoming Fakecest! Nanami Mineda

  • nanami mineda censoredcreampiemature womanJULmadonnamametaro mamezawaJUL-360JUL360jul00360
    • 2020-11-11
    41 min

    279UTSU-468 Yukasan

  • amateur censoredcreampiebig titsutsuutsu-468utsu468279utsu-468
    • 2020-11-15
    480 min

    [NPS-405]Female Director Haruna Amateur Lesbian Seduction 50 Ladies 8 Hours Best Selection Collection 15

  • megumi shino abe mikako censoredamateurlesbianNPSpetersnampaNPS-405NPS405h-021nps00405
    • 2020-11-20
    154 min

    [DOCP-259]My Neighbor With Big Tits Got Into A Fight With Her Boyfriend And Got Locked Out Of Her House, And She Looked So Sexy Standing There In Her Thin, Skimpy Outfit...

  • yulia kano asami nagase censoredcreampiebig titsDOCPprestigedoc premiumDOCP-259DOCP259118docp00259
    • 2020-11-23
    115 min

    [XVSR-565]Mother's Instinct On Full Blast Roleplay: I Wanna Be Coddled By Mama Yui! Yui Hatano

  • yui hatano censoredcreampiebig titsXVSRmax aikuzo yoshidacalenXVSR-565XVSR565xvsr00565
    • 2020-12-03
    61 min

    [per-345]かれん

  • amateur censoredamateurperper-345per345per-345
    • 2020-12-05
    60 min

    HEYZO 2408 After 6 -Big Tits Office Lady Is Ready To Be Fumbled With- – Kurumi Kokoro

  • kurumi kokoro uncensoredcreampieheyzo
    • 2020-12-05
    119 min

    [JUL-393]Bareback Adultery With The Shy Married Woman At My Workplace. Kana Mito

  • kana mito censoredcreampiemature womanJULmadonnayosukeJUL-393JUL393jul00393
    • 2020-12-06
    131 min

    [KATU-076]Perky Nipple Nurse - Busty Big Booty Cock-Loving Slut Goes Wild

  • censoredbig titsslutKATUkatsuo bussan mousouzokumaglowKATU-076KATU076katu00076
    • 2020-12-23
    21 min

    FC2PPV 1617518 [No] M man is blown by the popular Misa-chan with two big cocks in a row

  • amateur uncensoredfc2
    • 2021-01-06
    53 min

    [sika-002]あみ＆りか

  • amateur censoredcreampieuniformsikasika-002sika002sika-002
    • 2021-01-22
    140 min

    [IBW-815]S********ls Lured To A Local Apartment And Made To Fuck

  • amateur censoredbeautiful girlIBWi b worksIBW-815IBW815
    • 2021-01-25
    83 min

    [THNIB-068]The White Paper Of A Pure Younger Sister - Teen Glitter - Tomoka Hayasaki

  • censoredbig titsbeautiful girlTHNIBintec incTHNIB-068THNIB068h-706thnib00068
    • 2021-02-02
    60 min

    [KBTV-060]"Actually, I'm Worried My Cock Is Too Big" If We Confessed To Being Hung, Would A Girl's Curiosity And Maternal Instinct Get The Better Of Her？ We Find Out

  • censoredamateurKBTVmessy tvKBTV-060KBTV060h-1514kbtv00060
    • 2021-02-09
    140 min

    [SDAB-167]I Thought My Stepfather Was A Creepy Bastard, And He Had An Awful Personality, But Now, We Were All Taking A Family Vacation Together ... While Mother Was Nearby, This Man I Hated With A Passion Was Fucking My Brains Out, And Yet, I Found M

  • asai censoredschoolgirlbeautiful girlSDABsod creategoemonone s youthSDAB-167SDAB1671sdab00167
    • 2021-02-16
    131 min

    FC2PPV 1688712 Immediate purchase is advantageous ★ Genuine J 〇 Geki Kawarori big breasts ★ Honpo first public release ★ All the techniques to persuade from encounters are released at once ★ A total of 150 minutes or more blockbuster ★ Raw Saddle lim

  • amateur uncensoredfc2
    • 2021-02-17
    60 min

    [sika-038]14番メロンちゃん 2(18)

  • amateur censoreduniformschoolgirlsikasika-038sika038sika-038
    • 2021-02-21
    146 min

    [CAWD-189]Round And Cute! The 2nd AV Appearance With An Older Man Of Makoto Tsugumi, A Super Boyish Beautiful Girl With Big Tits Who Works At A Used Clothing Store! Maid Cosplay! POV! A First Experience That Will Make You Love Sex Even More! Creampie

  • makoto tsugumi censoredcreampiebig titsCAWDkawaiitake dCAWD-189CAWD189cawd00189
    • 2021-02-27
    120 min

    [MIRD-210]My Colleagues From My Part-Time Job Missed Their Last Train Home, So Now They're Spending The Night At My Place!! They're Unleashing Their Full Erotic Powers And Wiggling And Jiggling Those 4 Big Divine Titties Until The Break Of Da

  • tsubaki rika nene tanaka censoredbig titsslutMIRDmoodyzwild sevenmoodyz realMIRD-210MIRD210mird00210
    • 2021-02-27
    149 min

    [FONE-136]The Non-nude Erotica Of A Big Breasted, Fiery Girl: On The Day Of Shooting, She Gives An Electrifying AV Appearance - Rio

  • censoredcreampiebig titsFONEfirstplusFONE-136FONE136h-491fone00136
    • 2021-03-02
    129 min

    [MSFH-052]Coworker Temptation: Working Overtime With The Hottest Girl In The Office And She Seduces You And Drains Your Balls Dry Konomi Yoshinaga

  • konomi yoshinaga censoredsingle workMSFHsodms sodMSFH-052MSFH0521msfh00052
    • 2021-03-12
    208 min

    [MKMP-386]I Want Aoi Kururugi To Keep Fucking Me All Night Long

  • aoi kururugi censoredcreampieslutMKMPk m producesamoarimillionMKMP-386MKMP38684mkmp00386
    • 2021-03-13
    49 min

    C0930 hitozuma1350 Sae Nanmoku 26years old

  • amateur uncensoredc0930
    • 2021-03-21
    85 min

    FC2PPV 1735287 Testicle Massage ＃ 7 Kotomi Sakuraba [Tokyo Hands @ Men’s Esthetics]

  • amateur uncensoredfc2
    • 2021-03-27
    59 min

    FC2PPV 1742978 [None by just the face] Virgin, multiple, vaginal cum shot, nice ass, beautiful legs Ace Hime-chan advent! I can’t take this level so much [4K benefits available]

  • amateur uncensoredfc2
    • 2021-04-07
    62 min

    422ION-0065 A new wife who can not have children in the middle is a vaginal cum shot SEX to a cheating partner

  • amateur censoredcreampiemarried womanionion-0065ion0065422ion-0065
    • 2021-04-09
    115 min

    [PARATHD-3151]10 Hot And Steamy Lesbian Videos! Beautiful Girls Learning The Pleasure Of Having Their Pussies Touched By Women

  • censoredamateurlesbianPARATHDparadise tvPARATHD-3151PARATHD3151parathd03151
    • 2021-04-10
    146 min

    [DVAJ-509]My Wife Told Me All About Her Affair And It Made Me So Horny... I Took An Apology Out On Her Unfaithful Body Kurea Hasumi

  • hasumi claire censoredcreampiebig titsDVAJalice japankirinDVAJ-509DVAJ509dvaj00509
    • 2021-04-11
    107 min

    390JNT-019 [Cum I’m Going] I ● Put an erotic selfie on the star, pick up a G milk gal on SNS! !! Transcendental squirting constitution! !! Please burn your ears with the dirty words that pop out while you have convulsions! "It’s awesome

  • amateur censoredcreampiebig titsjntjnt-019jnt019390jnt-019
    • 2021-04-13
    75 min

    FC2PPV 1768335 First shot ♥ ️ Complete appearance ♥ ️ Fair-skinned slender beauty nude with body shape 165/40 ♥ ️ A neat active girl with a cute innocent smile ○ Raw 18 years old is half crying without thinking of the humiliation of her first experie

  • amateur uncensoredfc2
    • 2021-05-18
    61 min

    HEYZO 2519 Fuck My Ass! – Mai Amao

  • mai amao uncensoredcreampieheyzo
    • 2021-07-28
    58 min

    SIRO-4581 [First Shot] [Resilient Beautiful Breasts X Elastic Ass] [Tangled Rich Blowjob] The Crepe Shop Clerk With A Cute Smile Is A Carnivorous System. Stimulated By The Body Of M Temperament, When The Switch Comes In, Licks The Meat Stick Deliciou

  • amateur censoredamateursirosiro-4581siro4581siro-4581
    • 2021-08-09
    45 min

    230OREC-836 Suzu

  • amateur censoredamateurbeautiful girlorecorec-836orec836230orec-836
    • 2021-08-27
    104 min

    [YSN-557]I Want To Devour My Younger Stepsister"s Amazing Flesh Day And Night, Tsugumi Makoto

  • makoto tsugumi censoredcreampiebig titsYSNnonYSN-557YSN557h-127ysn00557
    • 2021-09-11
    150 min

    [ANKB-001]Lustful Play At An Open Air Gender-Neutral Bath With A Really Perverted Girl Who Has Super-Elastic H-Cup Tits

  • censoredcreampiebig titsANKBlove ma ko mousozokutakechanANKB-001ANKB001ankb00001
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-24
    149 min

    [AKID-087]Horny Insta-Fuck Girls Only We Took The Home For A Peeping Good Time And Then We Sold The Footage Without Permission As An Adult Video No.46 Emi / G-Cup Titties / 26 Years Old / Height: 165cm Nanae / D-Cup Titties / 23 Years Old / Height: 1

  • censoredcreampieblowjobAKIDomochikaeri mousozokumanji groupAKID-087AKID087akid00087
    • 2021-10-22
    150 min

    [CJOD-316]Julia Seduces Me In A Back Alley. Slutty Date Fucking And Hard Creampying Countless Times Until The Morning...

  • julia censoredcreampiebig titsCJODbitorendei yamaguchichijo hebunCJOD-316CJOD316cjod00316
    • 2021-11-07
    128 min

    300MIUM-758 [G Cup From H Cup] Rent A Manipulative Teacher As Her! Completely Rec The Whole Story That Was Spoiled Up To The Originally Prohibited Erotic Acts By Persuading! !! After Enjoying A Pool Date In A Swimsuit, Naked Sex & Erokos Oil Sex A

  • amateur censoredcreampiebig titsmiummium-758mium758300mium-758
    • 2021-11-15
    62 min

    FC2PPV 2421391 [Tsundere Lewd] Tsubasa ★ Super Beautiful Breasts Lewd Older Sister Defeats M-Type Uncle And Relieves Stress W. Amazing Blowjob Amazing Fucking ♪ Cowgirl That Is Too Intense And Too Erotic. Dere-The Sweetness Of Time Is Endlessly Cute

  • amateur uncensoredfc2
    • 2021-12-11
    134 min

    [CMV-161]Underground Idol"s Dark Work: Enema Brothel Anal Fuck Live Stage

  • narumi natsuki kotori shima censoredlesbiancosplayCMVcinemagicmarukatsuvixenCMV-161CMV161cmv00161
    • 2021-12-15
    80 min

    383REIW-100 Sparrow (Sho Sparrow)

  • amateur censoredcreampiebig titsreiwreiw-100reiw100383reiw-100
    • 2021-12-29
    123 min

    1Pondo 122921_001 Mikan Kururugi Emiri Okazaki: Sexy Actress Special Edition

  • amateur uncensored1pondo
    • 2022-01-01
    55 min

    Pacopacomama 010122_582 Happy New Year Orgy Reiko MizuharaHiromi Okura

  • amateur uncensoredpacopacomama
    • 2022-01-06
    60 min

    Pacopacomama 010622_587 The Trick For A Housewife, 27: Married Women Who Goes Nuts Nono Otsuki

  • amateur uncensoredpacopacomama
    • 2022-01-07
    150 min

    [SSIS-287]Drool, The Effects Of A Few Sips, Her Face During Sex, And Peeing Released All At Once. Yua Mikami Flies Indecently.

  • yua mikami censoredbig titssquirtingSSISs1 no 1 stylemon cSSIS-287SSIS287ssis00287
    • 2022-01-15
    121 min

    [GVH-345]A Woman Possessed By A Desire For Exhibitionism, A G*******g, And BUKKAKE. Mei Satsuki.

  • satsuki mei censoredslutsingle workGVHglory questusubashi suiGVH-345GVH345gvh00345
    • 2022-01-22
    115 min

    [MMUS-061]Beautiful Little Devil Temptation - Mai Hanagari

  • flower hunting censoredschoolgirlslutMMUSmarrionkijin kasaikcpMMUS-061MMUS061mmus00061
    • 2022-01-22
    64 min

    C0930 tk0051 Yumiko Nonoichi 28years old

  • amateur uncensoredc0930
    • 2022-01-27
    153 min

    [SPRD-1511]The Reality Is That My Father And Older Brother...Fuck My Wife... Hana Haruna

  • haruna hana censoredmature womansingle workSPRDtakara eizokouji takaraaleddinSPRD-1511SPRD151118sprd01511
    • 2022-01-28
    109 min

    [SHKD-986]After His Sentence, This Devilish Guy Fucked A Woman For The First Time In 10 Years. Hikari Ninomiya

  • hikari ninomiya censoredcreampiebeautiful girlSHKDattackersbungo maedasharkSHKD-986SHKD986shkd00986
    • 2022-02-04
    118 min

    [IPX-816]I"ll Reward You With My Mouth, Alright？ Fellatio Management By A Beautiful Boss Who Loves To Suck - Nanami Misaki

  • nanami misaki censoredblowjobslutIPXidea pocketzaku araidishIPX-816IPX816ipx00816
    • 2022-02-12
    128 min

    [KTKC-136]Hello, Ms. Plain but Colossal Tits. A Dirty Minded J-cup Kozue who Only Thinks Dirty Thoughts (20)

  • censoredcreampiebig titsKTKCkitixx mousouzokubig titsKTKC-136KTKC136ktkc00136
    • 2022-02-19
    241 min

    [SUPA-607]Please! Fill Me Up Inside! 50 S Class Amateur Women Crave A Creampie As They Get Lost In Pleasure On The Spot! 240 Minutes!

  • censoredcreampieamateurSUPAskyu shirotok taroSUPA-607SUPA607supa00607
    • 2022-02-20
    120 min

    300MAAN-749 [Under The Kimono Is A Lustful Sosol Slaughtered Body! De Nasty Female President Squeezes Ji Po! Cum Swallowing 4 Consecutive Shots! !! ] God-Like Body Female President And Sightseeing In Asakusa! The Guided Place Is ○ Purpose Toilet! A L

  • amateur censoredcreampiebig titsmaanmaan-749maan749300maan-749
    • 2022-03-06
    41 min

    494SIKA-149 Saddle A Stupid And Horny Big Tits Girl!

  • amateur censoredcreampiebig titssikasika-149sika149494sika-149



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored