high vision jav censored creampie beautiful breasts




FC2DASDNACXAMBINGODCESDRBDDTTONEZMIDVHDKASSISMEYDCHRVVEMAMVSDSANSPRDROYDVENUHODV

2020-11-07
191 min

[CMC-246]Cinemagic Catalog DVD 2019 - 2020

  • censoredCMCcinemagictakashi shirorakucollectCMC-246CMC246cmc00246
    • 2020-11-20
    119 min

    [HZGD-169]Trapped In Confinement At A Hot Spring Resort Inn... A Virtuous Wife Who Was Defiled Into Cum Crazy Pussy Juice-Soaked Orgasmic Insanity Through Aphrodisiacs And Experienced Sexual Techniques Michiru Manaka

  • aichi michiru censoredcreampiebig titsHZGDmarried woman flower garden theaterzampadesire married woman flower garden theaHZGD-169HZGD169h-1100hzgd00169
    • 2020-11-29
    81 min

    428SUKE-050 [Cum flight with a reward] Revolutionize Reina-chan. Plump meat, shaved slender money shortage cabin attendant! Sell your body for money ♪ Is it really just for money! ？？ Actively lewd blowjob by hitting Ma ● Ko with electric massage mach

  • amateur censoredcreampieamateursukesuke-050suke050428suke-050
    • 2020-12-01
    240 min

    [SIS-122]I Will Buy My Older Stepsister For The Day - 4 Hours

  • censoredcreampiebig titsSISglay zsisterSIS-122SIS12212sis00122
    • 2020-12-04
    46 min

    FC2PPV 1594613 ≪4K high-quality version≫ Sayuri 22 years old 158cm 42kg Beauty member ☆ Raw SEX with a beautiful woman with nice ass and fair skin! 2nd ♪ [Review benefits available] Vol.2

  • amateur uncensoredfc2
    • 2020-12-05
    147 min

    [PRED-273]Fresh Face Our Latest Exclusive Star Pristine Body Blessed By Nature. Watch A Shy, Good Girl Make Her Porn Debut Mami Sakurai

  • mami sakurai censoredsquirtingblowjobPREDpremiummichiru arashiyamaelegancePRED-273PRED273pred00273
    • 2020-12-08
    485 min

    [SDAM-060]Series' 50th Anniversary! Shy Girls' Slits Fall Prey To Dirty Deeds？! Wanna Try Going To The Men's Bath With Only A Single Towel On？ Experience The Thrill Of Going Totally Against The Rules - Horny Guys On A Mission, Their Cocks

  • censoredbig titsSDAMsodchain sousod createSDAM-060SDAM0601sdam00060
    • 2020-12-12
    164 min

    [JUFE-235]Special Summer Vacation With My Teacher... F-Cup But Slim Beautiful Y********l In Uniform Drenched In Middle-Aged Cum Karen Otoha

  • karen otoha censoredbig titssquirtingJUFEfitchJUFE-235JUFE235jufe00235
    • 2020-12-12
    149 min

    [DASD-777]She's Made Up Her Mind - Famous Pro Guitarist's Porn Debut! Natsuki Mizuno

  • mizuno nagisa censoredsquirtingbeautiful girlDASDdasinaballDASD-777DASD777dasd00777
    • 2020-12-24
    483 min

    [SHIC-198]Adolescence.com Adolescent Fiction 8 Hours The Best

  • censoredcreampiebig titsSHICadolscence.comSHIC-198SHIC198h-839shic00198
    • 2021-01-08
    11 min

    FC2PPV 1612266 [Personal shooting] Yayoi 23-year-old short SEX remastered version [Limited time offer]

  • amateur uncensoredfc2
    • 2021-01-11
    29 min

    FC2PPV 1641052 [Price for a limited time] The naughty shrine maiden of Hakurei Shrine squeezes sperm at the stakeout cowgirl position! 2 shots of vaginal cum shot!

  • amateur uncensoredfc2
    • 2021-01-22
    130 min

    [HZGD-177]"Sorry, Darling..." Bred By Her Father-In-Law On Her Ovulation Day - Wife Made To Take A Creampie Hana Haruna

  • haruna hana censoredcreampiebig titsHZGDmarried woman flower garden theaterhirokoji osakiimage married woman flower garden theatHZGD-177HZGD177h-1100hzgd00177
    • 2021-02-01
    300 min

    [DKSB-103]I Will Show You Hardcore Masturbation Of Amateur Girls: 39 People, 5 Hours

  • censoredamateurDKSBoffice k sk s bestDKSB-103DKSB10336dksb00103
    • 2021-02-05
    68 min

    FC2PPV 1672912 [No first shot] 145 cm minimum black hair Patsun girl Saori 19 years old 1 hour w [Personal shooting] I’m nervous about my first Gonzo

  • amateur uncensoredfc2
    • 2021-02-19
    43 min

    FC2PPV 1692819 [Uncensored] Fitting using a matching app. Slender huge breasts that don’t look good on your face.

  • amateur uncensoredfc2
    • 2021-03-01
    48 min

    FC2PPV 1706939 Infiltrate a woman’s house ★ 19-year-old neighborhood college student who matched with Tinder wants to be 〇 by a stranger Big tits metamorphosis beauty ★ First time limited unauthorized vaginal cum shot SEX video [37 minutes] 1 gi

  • amateur uncensoredfc2
    • 2021-03-25
    218 min

    [PIYO-110]Two Younger Stepsisters Dote On Their Older Stepbrother And Seduce Him With Their Tongues Slathered Over His Whole Body - He Can't Take It Anymore And They All End Up In A Raw Three-Some!

  • censoredcreampieschoolgirlPIYOhyokopiero dabicchiPIYO-110PIYO1101piyo00110
    • 2021-04-01
    155 min

    [ABW-077]【MGSだけのおまけ映像付き 20分】絶対的下から目線 おもてなし庵 従順小町 斎藤あみり 19

  • amateur censoredamateurabwabw-077abw077abw-077
    • 2021-04-03
    59 min

    188HINT-0448 Kiyoka

  • amateur censoredcreampiemarried womanhinthint-0448hint0448188hint-0448
    • 2021-04-03
    148 min

    [FLAV-265]HYPER FETISH A Naughty Queen In A High-Cut Outfit Hot Bitches With Crazy Makeup And Voluptuous J-Cup Titties Are Rude And Crude Flesh Fantasy Sex Monsters Shuri Hazuki

  • hazuki shuri censoredslutsingle workFLAVdigital arkdigital ark digital arkFLAV-265FLAV265flav00265
    • 2021-04-14
    119 min

    [TPPN-190](New Face Debut) Her First Ever Ecstasy! Pale, Beautiful Big Tits - She's Nervous But That Doesn't Get In The Way Of Her Orgasmic Pleasure!

  • censoredbig titsblowjobTPPNteppanTPPN-190TPPN190tppn00190
    • 2021-04-17
    136 min

    [JUL-539]I Can Never Tell My Wife That I Knocked Up My Mother-In-Law... I Lost Control And Gave Her My Creampie On Our One Night, Two-Day Hot Spring Vacation. Maiko Ayase

  • maiko ayase maria sawaguchi censoredcreampiemature womanJULmadonnaunicorn fukudaJUL-539JUL539jul00539
    • 2021-04-28
    16 min

    FC2PPV 1767791 [Personal shooting] Maria 27 years old short SEX remastered version [for a limited time]

  • amateur uncensoredfc2
    • 2021-05-01
    118 min

    [ADN-312]Forbidden Ravishment 6 The Too Young Step Mother Nanami Kawakami

  • kawakami nanami censoredsingle workdramaADNattackerssadao sadaokaotona no dramaADN-312ADN312adn00312
    • 2021-05-06
    62 min

    Caribbeancom 050621-001 A young wife who is taking out her trush sex so easy Mikuro Komori

  • mikuro komori uncensoredhandjobcaribbeancom
    • 2021-05-15
    151 min

    [KTKZ-086]Soft-bodied Virgin Haruki Ashina - Document Of The First Experiences Of This Music S*****t Who Studied Classic Ballet

  • haruki ashina censoredbeautiful girlsingle workKTKZkitixx mousouzokushinjinKTKZ-086KTKZ086ktkz00086
    • 2021-05-17
    102 min

    300MIUM-699 F Cup Beautiful Girl Still Growing! !! A refreshing fashion beautiful girl OL and a rhythmic gymnastics-prepared flexible body! I definitely want to conceive it! !! The best compatibility ● I’m sorry for the semen seeded in the po-me

  • amateur censoredcreampiebig titsmiummium-699mium699300mium-699
    • 2021-05-20
    78 min

    484SDGN-013 Let’s spread to the world! Nakadashi no Wa! I urged an AV actress and made a vaginal cum shot! ~ Chiharu Miyazawa ~

  • amateur censoredcreampiesquirtingsdgnsdgn-013sdgn013484sdgn-013
    • 2021-05-28
    85 min

    380SQB-103 Rui

  • amateur censoredamateursqbsqb-103sqb103380sqb-103
    • 2021-05-29
    59 min

    FC2PPV 1842562 [Complete amateur real video ＃ 40] Lori body x slender busty F cup! !! While playing with the old man’s penis, I tried to compare it with the actual "boyfriend’s is about this" w ＃ NTR ＃ first shooting

  • amateur uncensoredfc2
    • 2021-06-19
    161 min

    [MISM-203]Heart Closed, Anal Hole Open. Beautiful Girl With Zero Sexual Experience Wants It In The Back Door

  • censoredbeautiful girldeepthroatMISMm girls labMISM-203MISM203mism00203
    • 2021-06-26
    125 min

    [BIJN-202]The Documentary Climaxing Sex With Animalistic Instincts On Full Display! Tall Young Wife With Huge Tits And An Amazing Body Loses Her Mind Over A Thick Dick Orgy Miyabi Midorikawa

  • midorikawa miyabi censoredsingle workBIJNbijin majo emmanuelleBIJN-202BIJN202bijn00202
    • 2021-07-02
    104 min

    [ADN-328]Sweaty Noon Fucking With A Sexually Frustrated Married Woman - Tsumugi Akesato

  • akari tsumugi censoredsingle workADNattackersnaotootona no dramaADN-328ADN328adn00328
    • 2021-07-02
    61 min

    230OREC-811 Ran

  • amateur censoredcreampieamateurorecorec-811orec811230orec-811
    • 2021-07-17
    59 min

    FC2PPV 1924454 [18-Year-Old Idol Pregnant Woman] This Is A Beautiful Woman! During Idol Activity, Breaking The Ban On Romance And Discovering Pregnancy! The Office Is Furious! I Took A Gonzo Shot Of A Young And Cute Idol Pregnant Woman Who Had Troubl

  • amateur uncensoredfc2
    • 2021-08-07
    138 min

    [CEMD-042]I"ve Opened A Personal Sex Service! I"ll Make Your Wishes Cum True. Marina Saito Enjoy Sexual Services To Your Heart"s Content! Cum And Take A Closer Look!

  • marina saito censoredblowjobmature womanCEMDserebu no tomoCEMD-042CEMD042cemd00042
    • 2021-08-13
    60 min

    10musume 081421_01 A Call Girl In A Nurse Costume Who Even Gives You A Cleaning Blow Job Haruna Kawai

  • amateur uncensored10musume
    • 2021-08-14
    74 min

    523DHT-0286 Although It Looks Like An Adult, Maho, A Wife Who Is Too Erotic In The Generalized Erogenous Zone, Is 40 Years Old.

  • amateur censoredcreampiebig titsdhtdht-0286dht0286523dht-0286
    • 2021-09-04
    97 min

    300MAAN-692 [Tide Sommelier JD x Thick Ejaculation 3 Barrage] Tobisio Saddle Tide Pee … A Perverted Female College Student Adventing To The Tide! !! Golden Body With Beautiful Breasts And Nice Ass! !! What Does It Mean To Have A Cute Blow Job Fa

  • amateur censoredsquirtingamateurmaanmaan-692maan692300maan-692
    • 2021-09-05
    70 min

    413INST-156 [Active Model] Rookie Idols Weekly Magazine Scheduled To Be Published Squirting Individual Photo Session First Outflow [Creampie]

  • amateur censoredcreampieamateurinstinst-156inst156413inst-156
    • 2021-09-07
    474 min

    [KTRA-331]I Will Devote Myself To My Older Browther! My Younger Sister"s Slender Flat Chested Body. 8 Hour 4 Disc Set BOX

  • ok suzu yamai censoredcreampieKTRAke toraibuk tribeKTRA-331KTRA331h-094ktra00331
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-11
    140 min

    [URKK-044]I Get Fucked And My Tits Are Fondled Every Day By The Lewd Landlord Next Door - Riho Takahashi

  • riho takahashi censoredbig titssingle workURKKunfinishedrolandnyuukon no ichichichiURKK-044URKK044urkk00044
    • 2021-09-13
    58 min

    328HMDN-407 [Individual, 60th Road] Big Breasts Sexual Intercourse With G Cup Mother’s Sister. Gonzo Out Her Aunt Who Had Been Getting Nui From The Dc Era

  • amateur censoredcreampiemarried womanhmdnhmdn-407hmdn407328hmdn-407
    • 2021-09-18
    65 min

    C0930 ki210919 Norika Shimokawa 21years Old

  • amateur uncensoredc0930
    • 2021-09-18
    120 min

    [KSBJ-158]My New Stepmom Plays With Me - Mio Saionji

  • mio saizonoji censoredcreampieblowjobKSBJksb kikaku emmanuellesakura ninKSBJ-158KSBJ158ksbj00158
    • 2021-09-24
    119 min

    [HMN-052]Only I Know My Supervisor"s Other Face. If Our Absolute Sadist Of A Supervisor Calls You, You Come Right Away, And Empty Your Balls Into Her Promiscuous Mouth And Pussy Kozue Minami

  • minami kozue censoredcreampieslutHMNhonnakarassha miyoshiHMN-052HMN052hmn00052
    • 2021-11-09
    59 min

    [110921-001]Complaint Office Lady Apologize with the Body Vol.8 Cowgirl Dogeza! I"m sorry I"m the only one cum!

  • chiaki saeki uncensoredcreampiehandjobcaribbeancom
    • 2021-11-12
    89 min

    529STCV-036 The Flag-Raising With Adult Sex Appeal The Carnivorous Unequaled Female President Appeared! !! The Woman Who Can Work Is Also Top-Notch! Any Man Can Do It With Super-Dreadnought Tongue Technique! A Model-Class Slender Beauty Squirts Indec

  • amateur censoredcreampieamateurstcvstcv-036stcv036529stcv-036
    • 2021-11-12
    153 min

    [PPPD-976]I"m Underneath The Futon, Having Sex With My Brother"s Girlfriend, Trying Not To Get Caught. We"re Nice And Cozy In Here, And Her Big Tits Are Feeling Heavy On Me As She Furiously Piston-Pumps Me For Creampie Sex, Over And Over

  • hitomi censoredcreampiebig titsPPPDoppaiPPPD-976PPPD976pppd00976
    • 2021-11-13
    79 min

    [yss-092]ゆい(23)

  • amateur censoredsquirtingamateuryssyss-092yss092yss-092
    • 2021-11-13
    127 min

    [DDFF-017]A Barely Legal Babe In Shame Deep Throat Subjugation Maika Hiizumi

  • maika hizumi censoreddeepthroatsingle workDDFFdogmafk2DDFF-017DDFF017ddff00017
    • 2021-11-20
    127 min

    [DNAX-001]AV Debut Before Female Debut! They Try Everything On The AV Menu From Handjobs And Footjobs To Threesomes, Bondage, And Anal! Miho Sakaguchi

  • miho sakaguchi censoredanalcreampieDNAXnagiradorianDNAX-001DNAX001dnax00001
    • 2021-11-22
    75 min

    300MIUM-765 [Big Breasts Rocket Launcher Married Woman] Get A Transcendental Sexy Wife Who Walks While Shaking Her Boobs Vine Vine! Mutchimuchi’S Nice Ass Swallowing A T-Back! !! [Impact Extreme Erotic Body] "Don’T Insert It Because The

  • amateur censoredcreampiebig titsmiummium-765mium765300mium-765
    • 2021-11-25
    125 min

    [FSDSS-318]"Are You Interested In My Breasts？" Getting Hard As She Made Fun Of Me, I Ended Up Having Some Titty Fucking SEX With My Big Breasted Senior - Yuko Ono

  • yuko ono censoredbig titsdramaFSDSSfalenoshrimpfaleno starFSDSS-318FSDSS3181fsdss00318



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored