high vision jav censored upskirt miniskirt




FC2WANZKSBJSTARSADNHMNAVSAFSDSSGMEMATIDCHRVMEYDPPPDJUFEMARANACRMIDESPRDHUNTBAMBIMVSD

2020-12-12
20 min

FC2PPV 1603890 Planning to verify the tech of amateur men Bonus infiltrates an adult party 210 minutes

  • amateur uncensoredfc2
    • 2020-12-12
    43 min

    FC2PPV 1604020 * Uncensored * Appearance * Limited! !! !! Real married woman KUREHA in the 5th month of pregnancy ♡ After massaging a frustrated pregnant woman, she estrus and continues to live 3PSEX!

  • amateur uncensoredfc2
    • 2020-12-16
    136 min

    [GVH-169]Big Booty Bride Has Her First Anal Fuck With Her Father-In-Law Right At Home Miyuki Sakura

  • miyuki sakura censoredanalsingle workGVHglory questtorindoru tanakaGVH-169GVH16913gvh00169
    • 2021-01-01
    120 min

    [NACR-384]A Runaway And Me - Kaori Heisei

  • hira kiyoka censoredcreampiemarried womanNACRplanet pluscherryshichidomeNACR-384NACR384h-237nacr00384
    • 2021-01-05
    49 min

    Caribbeancom 010521-001 The high-end call girl who can make guys orgasm instantly! Emiri Momota

  • emiri momota uncensoredcaribbeancom
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-16
    141 min

    [YMDD-217]Reincarnated As A Sex Sleeve - Beautiful Get With Colossal Tits Continually Reborn As A Cum Dumpster Hana Himesaki

  • himesaki hana censoredcreampiebig titsYMDDmomotaro eizotommy boywakamomoYMDD-217YMDD217ymdd00217
    • 2021-01-19
    62 min

    HEYZO 2443 Orgasms With A Horny Pussy Girl Vol.11 – Kana Takashima

  • kana takashima uncensoredcreampieheyzo
    • 2021-01-29
    144 min

    [ABW-050]*Shitty NTR The Worst Ever Melancholic Erection I Loved My Girlfriend, And She Made A Promise That We Would Be Happy, But That Promise Was Broken When She Got Fucked By A Dirty Old Man. Non Nonoura

  • nonoura warm censoreddeepthroatsingle workABWprestigepunonpen ryouabsolutely wonderfulABW-050ABW050118abw00050
    • 2021-01-31
    300 min

    [HOIZ-013]Casual Fucks 7 - Amateur Girls Go Wild - Sex Selfies - Hookup Apps - POV - Amateur - Social Media - Secret Accounts - Facials - Big Tits - Curvy - Prim & Pretty - Slender

  • censoredbig titsamateurHOIZamateur seduction daydream familyHOIZ-013HOIZ013hoiz00013
    • 2021-01-31
    50 min

    493PKPD-080 [Odorless] Make a female K student squid with a big cock! Convulsions climax hell

  • amateur censoreduniformamateurpkpdpkpd-080pkpd080493pkpd-080
    • 2021-02-09
    64 min

    FC2PPV 1679109 [Personal shooting / set sale] The trial of a busty wife continues for her husband who continues to betray … ① & ②

  • amateur uncensoredfc2
    • 2021-02-12
    122 min

    [EYAN-164]Single Mother Can't Deny Her Female Instincts - Horny G-Cup Slut Misato, Age 28

  • censoredbig titsdeepthroatEYANe bodymichiru arashiyamawives of hanasagariEYAN-164EYAN164eyan00164
    • 2021-02-21
    118 min

    [CJOD-281]She Traveled From Our Country Home Without Permission And Came Over To My Place My Little Stepsister Loves Me (Her Big Stepbrother) Excessively, And When I Finally Gave In To Her Temptation, I Creampie Fucked Her, Over, And Over, And Over A

  • himesaki hana censoredcreampiebig titsCJODchijo heavenmametaro mamezawaCJOD-281CJOD281cjod00281
    • 2021-02-25
    124 min

    [JRZE-031]First Time Filming My Affair: Yu Nii

  • yu arai censoredcreampiemature womanJRZEcenter villagekotaro misatojurakuJRZE-031JRZE031h-086jrze00031
    • 2021-02-28
    120 min

    [XVSR-580]Erotic Novel: A Married Maid - Please Look At My New Wife's Body - Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiebeautiful girlXVSRmax ak c takedacalenXVSR-580XVSR580xvsr00580
    • 2021-03-11
    130 min

    [RCTD-388]Life Switch ~ Ultimate Step Father And Step Daughter Couple ~ Rika Tsubaki

  • tsubaki rika censoredbig titssingle workRCTDrocketroute yamazakiRCTD-388RCTD3881rctd00388
    • 2021-03-14
    74 min

    492MERC-251 Brown Girl 2

  • amateur censoredamateurbeautiful girlmercmerc-251merc251492merc-251
    • 2021-03-20
    95 min

    FC2PPV 1733805 Limited [Industry Revolution] Comedy erotic YouTuber excavation audition! Multiple counterattacks against the beautiful girl judges who are not good at virgin kun, continuous vaginal cum shot survival reality show * Prize 1 million yen

  • amateur uncensoredfc2
    • 2021-03-21
    120 min

    [JUL-507]The Story Of How I Spent Three Days Lovingly Fucking My Now Married Former Classmate When Visiting My Hometown Marina Shiraishi

  • rena shiraishi censoredbig titsmature womanJULmadonnajo asagiriJUL-507JUL507jul00507
    • 2021-03-29
    38 min

    362SCOH-041 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [I ● Ya] Ayame Hina

  • amateur censoredcreampieuniformscohscoh-041scoh041362scoh-041
    • 2021-04-12
    152 min

    [FONE-138]This Virgin Has A Curfew Of 7:00 p.m., And Now She's Making Her Cinderella Debut Rino Hanazawa - This Neat And Clean, Beautiful Girl Was Born Into A Family That Operated A Distinguished Confectionery Shop, And This Is A Documentary Abou

  • rino hanazawa censoredamateursingle workFONEfirst starhironobu kubota real nameplus first starFONE-138FONE138h-491fone00138
    • 2021-04-14
    157 min

    [JJBK-042]MILFs Only - Bringing A Hot Mature Woman Back To Your Place, Secretly Filming It, And Selling It As Porn 40 - She Craves Young Cock - Creampie Edition - Ms Takayo / G-Cup / Age 49 / Fingers Her Own Pussy Hard - Ms Misaki / H-Cup / Age 40 /

  • censoredmature womanJJBKjukujo bank emmanuellemanji groupJJBK-042JJBK042jjbk00042
    • 2021-04-17
    237 min

    [HNDB-190]Total Slut Wants To Drain Your Balls Dry - BEST Collection - Infinite Creampies For Your Hard Cock - All 34 Loads!

  • censoredcreampieslutHNDBhon nakaHNDB-190HNDB190hndb00190
    • 2021-05-22
    241 min

    [OKAX-738]Filthy Massage Parlor Where Beautiful Older Women Shake Their Hips And Cum 240 Minutes

  • censoredamateurmature womanOKAXk m producedick mandokuokazuOKAX-738OKAX738okax00738
    • 2021-05-27
    61 min

    336KNB-156 Super masochist wife who applied by saying "To add to life …"! Sexless with my husband for 10 years, but with saffle every month A neat and clean Yariman mature woman is blamed with words and gets excited and squirts a lot whi

  • amateur censoredmarried womansquirtingknbknb-156knb156336knb-156
    • 2021-06-02
    240 min

    [YVG-031]Once This Asshole Opens It Never Closes! Asshole Twitches And Convulses Covered In Juices! Intense Anal Fucking 10 Girls 240 Minutes

  • marie konishi shiratori shiratori censoredYVGglory questYVG-031YVG03113yvg00031
    • 2021-06-16
    155 min

    [SSIS-090]Aika Yumeno 's PLATINUM SOAP

  • yumeno aika censoredbig titssingle workSSISs1 no 1 stylehirokoji osakiSSIS-090SSIS090ssis00090
    • 2021-06-25
    102 min

    [YSN-551]My Father-In-Law's A Stud And I'm A Nympho: We Bang Around The Clock Yuri Honma

  • really censoredcreampiebig titsYSNnonYSN-551YSN551h-127ysn00551
    • 2021-06-29
    88 min

    300NTK-596 G Cup Reiwa Strongest Body Rookie Gravure! !! Raw chin high from the first low! !! Chuparu Chuparu is discovered as a big fetish! !! Then insert it all the way in pursuit of fetish! !! Shaking G milk! !! Beautiful face panting with pleasur

  • amateur censoredcreampiebig titsntkntk-596ntk596300ntk-596
    • 2021-07-12

    FC2PPV 1917845 [Fan Participation Type 4th] Hinata-chan is an amateur’s fingering! Raw SEX [Hinata Challenge] with a body that trembles

  • amateur uncensoredfc2
    • 2021-07-30
    40 min

    359TYVM-177 Incest I Dreamed Of … The Year’S Different Seeding Sex That Fulfills The Desire Of A Fifty Wife That My Son Wanted!

  • amateur censoredcreampiemarried womantyvmtyvm-177tyvm177359tyvm-177
    • 2021-08-07
    127 min

    [HOKS-101]Housewife and Whore, The Fallen Housewife In Her Fourties

  • chinatsu asamiya asano censoredmature womandramaHOKSfa pro platinumogurokku kinzoufa proHOKS-101HOKS101hoks00101
    • 2021-08-18
    98 min

    [ZOZO-073]A Physical Examination From The Immoral Health Care Provider Who Goes After High S*********ls - The Rei Edition -

  • censoredcreampieZOZOsadie willenauZOZO-073ZOZO0731zozo00073
    • 2021-08-21
    131 min

    [DBER-122]Female Body On The Edge Of Death Will Fall Into The Pits Of Hell Sinking Into The Hell Of Iron Chains Episode 11: After She Is Captured By The Black Demons, The Powers Of The Strongest Warrior Goddess Are Sealed And They Eat Her Up Nanako M

  • nanako miyamura censoredsingle workDBERbaby entertainmentkikubonred babeDBER-122DBER122dber00122
    • 2021-09-03
    173 min

    [CAWD-284](Her Hobby: Collecting Adult Sex Toys) A Perverted, Glamorous, Beautiful Woman Who Is Waiting For Her Boyfriend And Loves To Fuck Handsome Middle-Aged Men In Her Mind Is Making Her Creampie NTR Debut! Kurumi Kirishima

  • kirishima walnut censoredcreampiebig titsCAWDkawaiimamezawa mametarouCAWD-284CAWD284cawd00284
    • 2021-09-06
    69 min

    FC2PPV 2158392 Active Third Grader Of Fair-Skinned Beautiful Milk E Cup. Although She Is A Small Animal Raised In The Countryside, A Large Amount Of Love Juice Overflows From Her Vagina. She Secretly Half Vaginal Cum Shot While Watching The Swaying B

  • amateur uncensoredfc2
    • 2021-09-17
    149 min

    [PRED-342]The New Female Teacher Gets Fucked - These Horny S*****ts Are In A Pregnancy Fetish Race To Get The Most Creampie G*******g For Their Buck - Mami Sakurai

  • mami sakurai censoredcreampiesingle workPREDpremiumakai suiseielegancePRED-342PRED342pred00342
    • 2021-09-20
    48 min

    FC2PPV 2227960 The Day When I Got Excited By Making An Important Fair-Skinned Girl Raped By Another Person Who Likes Estrus

  • amateur uncensoredfc2
    • 2021-09-29
    69 min

    511SDK-016 [All The Details Of The Affair Scene] There Are Dates, Remote Vibes, And Gonzo. Affair Wife Immersed In Pleasure

  • amateur censoredcreampiemarried womansdksdk-016sdk016511sdk-016
    • 2021-10-22
    124 min

    [HMN-058]Fresh Face. Recruiting A Step-sister With A Cute Smile In Her Underwear For Serious Sex. Putting On Her Bra And Panties For Sexy Temptation. Fucking For A Creampie Load In Her AV Debut! Asuka Yumesaki

  • asuka yumesaki censoredcreampiesingle workHMNhonnakarassha miyoshiHMN-058HMN058hmn00058
    • 2021-10-23
    242 min

    [NASH-590]Real Sexy Stories 26

  • shota chisato asagiri yu censoredbig titsmature womanNASHnadeshikoNASH-590NASH590nash00590
    • 2021-11-05
    122 min

    [UMD-801]Pervert At Gyno Clinic! 14 Unknowing Young Wife Is Creampied During Treatment!!

  • himari kinoshita himari hanazawa hikari sena censoredbig titsUMDleodoragon nishikawaUMD-801UMD801125umd00801
    • 2021-11-07
    49 min

    FC2PPV 2410087 [New Work, Half Price! ] ♀43 Professional Student Mi ◯ -Chan 20 Years Old 2nd Time (3p) Conceived Ojisan And Black Brother’S Super-Rich Sperm Double Cum Shot! Which Baby Is The Second Undesired Unfortunate Pregnancy？ ？？ (LOL)

  • amateur uncensoredfc2
    • 2021-11-09
    60 min

    SIRO-4631 [First Shot] [Stunning Y-Shaped Balance] [De M Baby Face JD] Excavation Of Lewd JD With Excessive Libido To Masturbate 6 Times A Week In The Morning And Evening. A Fresh Body Full Of Youthful Desire Away From Sex Has Culminated Many Times D

  • amateur censoredamateurbeautiful girlsirosiro-4631siro4631siro-4631
    • 2021-11-13
    117 min

    [BKD-272]Stepmother/Stepson Fucking [Paths of Shimoisano] Izumi Sakuma

  • izumi sakuma censoredcreampiemature womanBKDtsuji koujitsuji koujirubyBKD-272BKD272bkd00272
    • 2021-11-13
    139 min

    [MMYM-050]Gorgeous And Innocent Dirty Talk Gal AIKA Is Mega Horny With Intensely Emotional Orgasms

  • aika censoredslutsingle workMMYMmarrionyumeno aidayumenoMMYM-050MMYM050mmym00050
    • 2021-12-02
    46 min

    FC2PPV 2482798 [Personal Shooting] Convenient Tadaman. I’ve Always Wanted To Do It … Mika Yamashita (23 Years Old) Blames Gon For Saffle

  • amateur uncensoredfc2
    • 2021-12-03
    162 min

    [JUFE-349]The Beautiful Curves Of A Dripping Wet, G-Cup Titty Body!! A Former Local Announcer Nao Yuri 3 Hourglass Curved Orgasmic Fucks

  • yuuri nao censoredbig titssquirtingJUFEfitcharashiyama michiruJUFE-349JUFE349jufe00349
    • 2021-12-09
    486 min

    [FCDSS-020]Tina Nanami"s Instinctive Charming Sex With FALENO. 19 Works. Best 8 Hours

  • nanami tina censoredbeautiful girlslutFCDSSfalenofaleno starFCDSS-020FCDSS0201fcdss00020
    • 2021-12-18
    123 min

    [ZOCM-014]Her Titties Were So Big, They Were Bursting Out Of Her Uniform, And Setting The Internet On Fire! This Colossal Tits Beautiful Girl Was Hotly Rumored Online, With Her 101cm J-Cup Titties, And How Good She Looked In Uniform, But It Turns Out

  • suwon miso censoredcreampiebig titsZOCMthrilling girls the daydream tribetodothrilling girlsZOCM-014ZOCM014zocm00014
    • 2022-01-06
    76 min

    [REBD-616]Asuka 2: Blue Waters! Asuka Momose"s Smile!! Asuka Momose

  • momose asuka censoredsingle workREBDrebeccatwo zebunREBD-616REBD616h-346rebd00616
    • 2022-01-15
    111 min

    [ONIN-072]Nice Girls Who Will Wash You With Their Bodies In The Bath And Suck Your Cock

  • censoredbig titsblowjobONINtamanegi mousouzokured startamanegiONIN-072ONIN072onin00072
    • 2022-01-18
    34 min

    [230OREC-994]まお

  • amateur censoredbig titsamateurorecorec-994orec994230orec-994
    • 2022-02-05
    124 min

    [AVSA-191]Super Fisheye Fetishism: Powerful & Exciting Images Of A Curvy Masochist--Masked Masochism

  • censoredbig titsAVSAavs collector sbuddha davscollector sAVSA-191AVSA191avsa00191
    • 2022-03-22
    120 min

    SAN-046 Anti-social Reclusive Cherry Boy Step-son Rebelling Against His Step-father Gets His Virginity Taken By His Stepmom. Chiharu Miyazawa

  • chiharu miyazawa censoredsingle workdramaSANmotherkabin kizakuramother motherSAN-046SAN046h-796san00046



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored