high vision javcensored creampie amateur jav




FC2BLKMIDVSSNICESDPREDNACRMIAAWAAAHMNFSDSSNATRSPRDBBANRBDSHKDSSISVENXSANHODVHDKA

2020-09-24
78 min

[REBD-496]Yuna Cheering For You/Yuna Otsuha

  • yuna otoha censoredsingle workREBDrebeccahellpess takaREBD-496REBD496h-346rebd00496
    • 2020-10-06
    140 min

    [KMHRS-027]I Want To Suck Plenty Of Cocks, So We'll Give Her 15 Dicks To Suck, And We Want All Of Them To Shower Her With Bukkake Semen Splatters! Laila Takizawa

  • lyra takizawa censoredamateursingle workKMHRSsod createtrendy yamaguchikimihoreKMHRS-027KMHRS0271kmhrs00027
    • 2020-10-09
    108 min

    [SKEJ-003]I Want To Make My Husband Happy So Much I Am Going To Be Fucked By Someone Else

  • censoredcreampiebig titsSKEJamateur time daydream groupSKEJ-003SKEJ003skej00003
    • 2020-10-11
    108 min

    [HERY-106]A Man's Daughter Turned Into A Complete Bitch Collection 4 - Sakuya Yuki

  • sakiya yuki censoredcreampiesingle workHERYyellow mousouzokudr fuyellowHERY-106HERY106hery00106
    • 2020-10-20
    52 min

    300NTK-452 Gekokujo Piston! !! Bullying daughter Yariman beauty gal with a different adult Ji ○ Ko and intense piss revenge! !! Boneless with continuous vaginal cum shot to Yariman Galma Co ○ who is splendidly cheating! ？？ This is a real pleasure 10

  • amateur censoredcreampieamateurntkntk-452ntk452300ntk-452
    • 2020-11-18
    240 min

    [RVH-006]A Sexy P*A Director & A Mind-Blowing Female Teacher And A Bad Boy S*****t Council President Best Hits Collection vol. 1

  • hitomi enjo gloss hall shiori endo bookmark censoredRVHglory questRVH-006RVH00613rvh00006
    • 2020-11-19
    52 min

    H4610 ki201119 Kokoro Kirikawa 26years old

  • amateur uncensoredh4610
    • 2020-11-20
    77 min

    [OTIM-044](Streaming Exclusive) (Daydream POV) Ordinary And Nonchalant But With A Body I Want To Fuck Yukino Nagasawa

  • yukino nagasawa censoredcreampiebig titsOTIMprestigeonetimeOTIM-044OTIM044118otim00044
    • 2020-12-03
    74 min

    435MFC-060 Saya

  • amateur censoredcreampieamateurmfcmfc-060mfc060435mfc-060
    • 2020-12-18
    50 min

    FC2PPV 1590955 [Personal shooting] Appearance / Yukari 37 years old / A large amount of Tokuno sperm has been vaginal cum shot to a married woman who is aggressive in sex! !!

  • amateur uncensoredfc2
    • 2020-12-20
    30 min

    FC2PPV 1613260 A beautiful nurse model shooting a lascivious shaved pussy sticking to a cock and a cock is stimulated, … [Amateur individual shooting original FHD high quality ZIP download available]

  • amateur uncensoredfc2
    • 2020-12-20
    136 min

    [HND-921]She's Fucked 300 Guys In Chiba Alone! Super Sexy Tanned Slut Wants To Make Memories By Taking Your Creampie - Her Porn Debut Rio Sakune

  • sakune rio censoredcreampiesingle workHNDhon nakamametaro mamezawaHND-921HND921hnd00921
    • 2020-12-27
    125 min

    [KNAM-030]All Raw STYLE @ Mona # Bratty Young Slut # Her Panties Are Soaked # Her First Compensated Date # Powerful Pussy # Completely Raw Fuck # Buckets Of Cum Mona Amemiya

  • amemiya mona censoredcreampieblowjobKNAMfirst star100 raw styleKNAM-030KNAM030h-491knam00030
    • 2021-01-05
    62 min

    SIRO-4382 [First shot] [I love the back of the vagina] [Traceful luster blowjob] Professional student who is curious about naughty things. If you feel like you’re sick of stimuli other than masturbation after a long time and keep knocking on the

  • amateur censoredamateursirosiro-4382siro4382siro-4382
    • 2021-01-16
    242 min

    [MXSPS-660]REQUEST - Beauty With A Beautiful Ass, Rin Asuka

  • asuka ri censoredbig titsmarried womanMXSPSmaxingMXSPS-660MXSPS660h-068mxsps00660
    • 2021-01-29
    64 min

    FC2PPV 1664016 ☆ 1000pt OFF until February 7th for a limited time! !! [No / piece] L cup miracle chubby daughter Natsuki-chan and Gonzo! !! It’s too chubby and there’s no other explanation! !! * High-quality review benefits available

  • amateur uncensoredfc2
    • 2021-02-05
    98 min

    277DCV-175 Is it okay to send it home？ case.169 This is a live-action version of ○ Totsumachi Pupe ○! Miss Ka * na-like F-cup cabaret who lives in a chaos room! ⇒Unprecedented Ferateku + 4 production ⇒ I can not imagine from a cool face ⇒ Dick addict

  • amateur censoredbig titsamateurdcvdcv-175dcv175277dcv-175
    • 2021-02-11
    135 min

    [IENF-124]Amateur Pick Ups - Tiny Girls We Spotted In Aoyama Take Massive Cocks - She Offered A Thigh Fuck, But What If She Got Horny Enough To Spread Her Legs.

  • censoredcreampieamateurIENFienergytiger kosakaiienfIENF-124IENF1241ienf00124
    • 2021-02-12
    43 min

    [CLO-125]Lewd Kissing, Almost Like Intercourse Riko Honda

  • honda censoredblowjobmature womanCLOchobitchchovicCLO-125CLO125h-1435clo00125
    • 2021-03-15
    63 min

    328HMDN-345 [W Demon Cock x Married Woman Orgy 3P] Day Face Dirty Wife Yuri (pseudonym) 26 years old I’m cheating because I’m not satisfied. Deep kiss by drinking a whole cock with a pussy that wants sperm other than her husband. Fertilizat

  • amateur censoredcreampiemarried womanhmdnhmdn-345hmdn345328hmdn-345
    • 2021-03-23
    723 min

    [SDJS-109]SOD Female Office Worker Super Elegant Version Yearly Activity Report 2017 / 2018 / 2019 3 Video Collection Of 3 Years Worth Of Porn Films

  • koike masami ichikawa censoredbig titsamateurSDJSsod createsod jouko shainSDJS-109SDJS1091sdjs00109
    • 2021-04-09
    121 min

    [IPX-648]My Teacher Miss Kijima Shakes Her Hips Sweetly And Smiles As She Seduces And Fucks Younger Men Airi Kijima

  • airi kijima censoredslutsingle workIPXidea pocketdishIPX-648IPX648ipx00648
    • 2021-04-09
    120 min

    [MDTM-716]The Cutest And Smartest S*****t In Class Complete POV Sex With That Girl In A School Uniform You Always Had A Crush On Natsu Tojo

  • natsu tojo censoredcreampieschoolgirlMDTMuchu kikakutodoMDTM-716MDTM716mdtm00716
    • 2021-04-10
    111 min

    [VENX-024]Step Family G*******g My Beautiful Step Aunt Akane Shiki

  • akane shiki censoredcreampiemature womanVENXvenussarufakecest winntersVENX-024VENX024venx00024
    • 2021-04-10
    151 min

    [CHRV-129]My Stepsister Loves To Get Spanked! If You Smack Her Booty She Gets Tight! She's Got Colossal Tits Too: 40" H-Cup Yume

  • censoredcreampiebig titsCHRVcherry revolution daydream tribecherry s reboCHRV-129CHRV129chrv00129
    • 2021-05-01
    123 min

    [MARA-059]Yume Natsuki In The Colossal Tits Theater 93cm H-Cup Titties!

  • natsuki yume censoredcreampiebig titsMARAplanet plusdirector omarakasMARA-059MARA059h-237mara00059
    • 2021-05-22
    259 min

    [NATR-658]On Display! Reika Hashimoto

  • reika hashimoto censoredmature womansingle workNATRnadeshikoNATR-658NATR658natr00658
    • 2021-06-16
    150 min

    [HUNTB-031]I Thought For Sure This Gaming Party Would Be All Guys, But Actually There's Only One Dude - Me! A Hot Pot Offline Meetup Filled With Hot Girls. 2

  • censoredcreampieHUNTBhunterkawajirihhh groupHUNTB-031HUNTB031huntb00031
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-20
    63 min

    FC2PPV 1878480 [Reading notice] Infiltrate the SEX housing complex where married women and SEX addicts ♀ are invading! An H-cup woman who is crazy about sexual desire at an orgy party that is opened every day! All you can commit! All-you-can-eat vagi

  • amateur uncensoredfc2
    • 2021-06-25
    121 min

    [MIAA-460]Substitute Pregnancy Wife - Beloved Stepdaughter Cums And Gets Pregnant While Fucking Stepfather - Rina Takase

  • rina takase censoredcreampieslutMIAAmoodyzhiromichi hoseeveryone s porn starMIAA-460MIAA460miaa00460
    • 2021-08-10
    90 min

    484SDGN-016 God Body Shop Clerk I Like Raw! I Like Eroticism! I Have Made A Vaginal Cum Shot On A Pie Bread That Has Accumulated Sexual Desire After Drinking Alcohol!

  • amateur censoredcreampieamateursdgnsdgn-016sdgn016484sdgn-016
    • 2021-09-02
    71 min

    [REBD-586]Kiu - Bratty Girl Limit Break. Kiu Aihara

  • aihara tsukiha censoredsingle workREBDrebeccaherpes takaREBD-586REBD586h-346rebd00586
    • 2021-09-03
    119 min

    [MIDE-968]I Was Betrayed By My Boss And Had Sex With The Business Partners Mizuki Aiga

  • mizuki ai censoredcreampiesquirtingMIDEmoodyzkindaichishougo roumoodyz divaMIDE-968MIDE968mide00968
    • 2021-09-04
    245 min

    [SORA-331]The Erotic Terrorist I Pray That You Will Awaken To The Pleasures Of Outside Nudes It"ll Be Trouble If You Ejaculate Here, But This Dirty JK Slut Will Tempt You With Dirty Talk, And Drain Your Balls Dry Of Your Semen Ai Kawana

  • ai kawana censoredschoolgirlblowjobSORAyama to soradenchuuSORA-331SORA331sora00331
    • 2021-09-14
    74 min

    200GANA-2557 Seriously Nampa, First Shot. 1689 "Why Don’t You Pay For It And Eat Together？ 』 Hyoi Hyoi Will Follow You Norinori Gal! The Low Chastity Idea Of ​​Her Who Accepts Her Drunk Without Resistance When Approaching Her Is Good! Look A

  • amateur censoredamateurganagana-2557gana2557200gana-2557
    • 2021-09-18
    243 min

    [GS-2024]Peeping In On A Sexual Massage Salon, The BEST, February 2020 - December 2020 12

  • amateur censoredGSgosGS-2024GS2024
    • 2021-09-27
    43 min

    FC2PPV 2253450 Appearance! !! Limited Number! [Uncensored] Cuteness, Sexyness, Lewdness … Creampie In A Fair-Skinned Gcup Beauty With A Beautiful Look !! (Part 1)

  • amateur uncensoredfc2
    • 2021-10-01
    136 min

    [ATID-483]Video Record Of A Mistress Secretary"s Thick Breaking In - Maron Natsuki

  • marin natsuki censoredcreampiesingle workATIDattackersin madATID-483ATID483atid00483
    • 2021-10-02
    227 min

    [SORA-337]A Cum Swallowing Date With A Blowjob Buddy A Meaty And Voluptuous Office Lady Is Seriously Cumming And Pissing Herself Silly! She"s And Exhibitionist, Opening The Golden Shower Floodgates While D***king Down 6 Cum Shots!! Kurumi Tamaki

  • tamaki walnut censoredblowjobsingle workSORAyama to soradenchuuSORA-337SORA337sora00337
    • 2021-10-29
    121 min

    [JJDA-023]This Kind And Gentle Big Tits Sister-In-Law Let Her Shut-In Cherry Boy NEET Little Stepbrother Fuck Her In An Attempt To Get Him Back Into Society Ren Usui

  • usui ren censoredcreampiebig titsJJDAjukujo daigaku jukujo manjigroupJJDA-023JJDA023jjda00023
    • 2021-10-29
    161 min

    [MIFD-187]Slightly Boyish and Slightly Sensitive 19 Year-Old Downtown Exotic Chic Phillipina Mixed-Race Beautiful Girl AV Debut Ran Ayase

  • ran ayase censoredbeautiful girlsingle workMIFDmoodyztorendei yamaguchimoodyz freshMIFD-187MIFD187mifd00187
    • 2021-10-30
    42 min

    481SACZ-084 Lina 1

  • amateur censoredbig titsamateursaczsacz-084sacz084481sacz-084
    • 2021-11-06
    134 min

    [BAHP-094]Breaking In Masochistic Women Club - Sara Kanami

  • kagami sara censoredsingle workbukkakeBAHPbarutanusubashi suihoppinBAHP-094BAHP094bahp00094
    • 2021-11-06
    70 min

    H4610 tk0046 Aisa Katsura 20years old

  • amateur uncensoredh4610
    • 2021-11-06
    134 min

    [AVSA-183]SUPER FISHEYE FETISHISM Powerful and Sexy Images of Slutty Body of Female Teacher Reiko Kobayakawa

  • kobayakawa reiko censoredbig titsmature womanAVSAavsbuddha davscollectorsAVSA-183AVSA183avsa00183
    • 2021-11-13
    122 min

    [ZOCM-011]Spend All Night Making Babies With Adulterous Creampie Sex In Love Hotel Shared With Plain S*****t. Beautiful Fair-Skinned Girl Mai-Chan. Mai Kagari

  • flower hunting censoredcreampieuniformZOCMzokuzoku musume mousouzokutodozokuzoku musumeZOCM-011ZOCM011zocm00011
    • 2021-12-11
    153 min

    [DGCEMD-098]*For Streaming Editions Only! Cums With Bonus Footage* Teary-Eyed, Non-Stop, Furious Orgasmic Sex 14 Meru Ito

  • ito meru censoredmature womansingle workDGCEMDceleb no tomoDGCEMD-098DGCEMD098dgcemd00098
    • 2022-01-07
    124 min

    [BOBB-329]New Face Debut! Bury Yourself In These Overwhelming And Impressive J-Cup Tits! Boin "Megumi Tachibana" Box

  • tachibana megumi censoredbig titssingle workBOBBabc mousouzokuboinbb abcBOBB-329BOBB329bobb00329
    • 2022-01-07
    52 min

    FC2PPV 2577307 [Personal Shooting, Limited Quantity Pt Off] "The Taste Of Other Sticks Was Exceptional …" The Secret Of The 34-Year-Old Wife Continues ②

  • amateur uncensoredfc2
    • 2022-01-21
    169 min

    [SSIS-305]Izuna Maki"s Retirement Porn Star"s Best Ever Show-Stopping Aphrodisiac Sex! 3 Rounds

  • izuna maki censoredsquirtingsingle workSSISs1 no 1 stylemon cSSIS-305SSIS305ssis00305
    • 2022-01-22
    178 min

    [DGCEMD-119]-Online Only! Includes Bonus Footage- Stepmom/Stepdaughter Lesbians - Ayaka Mochizuki, Kayo Iwasawa - One Naughty Stepdaughter Can"t Get Enough Anal From Her Freaky Stepmom!

  • ayaka mochizuki kayo iwasawa censoredbig titslesbianDGCEMDcelebrity friendsDGCEMD-119DGCEMD119dgcemd00119
    • 2022-01-26
    85 min

    435MFC-176 ["I Can’t Show This To My Kids ♪" Plump Super Soft Big Tits Super Cute Babysitter And Carnal Affair] It’s Over When The Family Gets Caught! Sex Appeal That Is Incomparable To My Wife Munmun Muchimuchi Big Pie A Raw Affair

  • amateur censoredcreampiebig titsmfcmfc-176mfc176435mfc-176
    • 2022-02-08
    300 min

    [388GOJU-192]熟女の匂いたつフェロモンムンムン淫乱脚コキと脚フェチSEX！！ベストコレクション 5時間 烏丸まどか 小野さち子 中西江梨子 鈴宮あき 汐河佳奈

  • amateur censoredmarried womanamateurgojugoju-192goju192388goju-192
    • 2022-03-05
    91 min

    300MAAN-754 [Sugar Content 200 ♪ Sweet Tsundere Angel] The Sweet Party JD Found At Tamachi Station! !! With A Pretty And Fresh Smile And A Creamy Tongue, You Can Make A Man Flutter W Ears, Nipples, Chestnuts, Inside! !! Almost Systemic Erogenous Zone

  • amateur censoredcreampiesquirtingmaanmaan-754maan754300maan-754
    • 2022-03-19
    68 min

    230ORECO-023 Ema-Chan (Aima Ichikawa)

  • amateur censoredcreampieschoolgirlorecooreco-023oreco023230oreco-023



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored