high vision javcensored planning couple censored




FC2NNPJHZGDWANZVENUATIDROYDSPRDSQTEPPPDCESDCAWDAVSASSNIBBANSDABABWAPODDASDNACRAUKG

2020-11-06
114 min

[SHKD-911]She Was Trying To Avenge Her Father, But... This Female Detective Was Captured By The Sinister Organization, And Subjected To Sex For A Year Minori Hatsune

  • hatsune minori censoredbig titssingle workSHKDattackerskinsharkSHKD-911SHKD911shkd00911
    • 2020-11-18
    121 min

    [GVH-155]The Groom Is Going For His Mother-In-Law's Excessively Filthy Big Tits Mari Kuroki

  • kuroki mari censoredcreampiebig titsGVHglory questGVH-155GVH15513gvh00155
    • 2020-11-18
    43 min

    FC2PPV 1573985 New project ❤️ First shot ❤️ Hidden shot ❤️ Idol face ❤️ Natsu-chan has been vaginal cum shot at a manga cafe ~

  • amateur uncensoredfc2
    • 2020-11-18
    85 min

    415LAS-031 Nanako

  • amateur censoredsquirtingamateurlaslas-031las031415las-031
    • 2020-11-19
    37 min

    285ENDX-312 20-year-old female college student with cute double teeth (Nozomi) Squirting screaming many times with SEX (2 times of raw chin cum shot) for the first time in a year

  • amateur censoredcreampiesquirtingendxendx-312endx312285endx-312
    • 2020-11-24
    40 min

    FC2PPV 1582030 [Limited quantity 2980pt → 1980pt] Bottomless libido monster beauty member Yuko ❤️ Night crawling play after staying erotic massage ❤️ Please help erotic activities because I can not handle it alone ❤️ Purchase privilege is 3 past work

  • amateur uncensoredfc2
    • 2020-12-01
    240 min

    [SCR-258]Hated Relatives: Rough Sex Paying A Night Visit To His Step-family, Including The Younger Sister, Older Sister And Niece: Posted Video Collection, 16 People, 4 Hours

  • censoredcreampiebeautiful girlSCRglay zs crimeSCR-258SCR25812scr00258
    • 2020-12-05
    120 min

    [JUL-388]A High-Class Prostitute Nao Jinguji An Alluring And Exquisite Married Woman Achieves The Ultimate Level Of Beauty

  • jinguji temple nao censoredbig titsmature womanJULmadonnakitorune kawaguchiJUL-388JUL388jul00388
    • 2020-12-18
    69 min

    FC2PPV 1601008 [Cosplay 2 barrage] Yurina [Individual shooting] Let a country girl with super beautiful big tits swimsuit and blame lotion vibrator! Furthermore, Blumacos! Bloomers are shifted and standing back is slammed ♪ Saddle rolled! Beautiful b

  • amateur uncensoredfc2
    • 2020-12-24
    158 min

    [SVDVD-833]Wanted: Amateur Young Wives To Take The Machine Vibrator Challenge! After They Get Their Pussies Nice And Stimulated By The Sensual Massage Machine, If They Can Avoid Squirting Until The End, Even After Receiving High-Speed Piston-Pounding

  • censoredcreampiesquirtingSVDVDsadistic villagesushi yokuboSVDVD-833SVDVD8331svdvd00833
    • 2020-12-25
    242 min

    [NASH-430]Conquer And Claim - Cheating Wives BEST Collection 4 Hours

  • censoredbig titsmature womanNASHnadeshikoNASH-430NASH430h-067nash00430
    • 2020-12-28
    63 min

    SIRO-4361 [First shot] [Secrets of a neat office lady] [Cum that never ends] A tall model with big breasts had a pure personality with one experienced person. Her body was accustomed to doing it alone .. AV application on the net → AV experience shoo

  • amateur censoredbig titsamateursirosiro-4361siro4361siro-4361
    • 2020-12-31
    63 min

    345SIMM-586 Beautiful Breasts Young Wife Enjoys Creampie 3 Times According To Home Cheating Video

  • amateur censoredcreampiemarried womansimmsimm-586simm586345simm-586
    • 2021-01-01
    60 min

    324SRTD-0207 The girl who looks neat is actually lewd! ？？ Since it says “put it in”, insert it without permission, vaginal cum shot ~

  • amateur censoredcreampieamateursrtdsrtd-0207srtd0207324srtd-0207
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-22
    65 min

    [orex-191]まや 2

  • amateur censoredcreampieamateurorexorex-191orex191orex-191
    • 2021-01-24
    125 min

    [GENM-071]Vivid POV - She'll Do Anything To Pay Her Bills Suzu Ayano

  • ayano suzuju censoredsingle workGENMgenekig 3GENM-071GENM071genm00071
    • 2021-01-27
    245 min

    [MCST-005]Family Fun (MCST-005)

  • censoredcreampieMCSTmercurystrawberryMCST-005MCST005h-1133mcst00005
    • 2021-02-01
    220 min

    [YMDD-219]Home Delivery Gal! Battle To Compare Your SK**ls And See How Much You Can Cum! Death Match: How Many Shots Can You Get Off？ vol. 02

  • ran tsukishiro yuka hoshi censoredcreampiehandjobYMDDmomotaro eizohimu lockwakamomoYMDD-219YMDD219ymdd00219
    • 2021-02-05
    52 min

    FC2PPV 1671668 Chiharu 21-year-old F cup x plump female college student! Estrus with sexual desire that overflows because I like sex too much! Cum indecently with a sensual body! Creampie with seeds on a plump body that is the best to hold!

  • amateur uncensoredfc2
    • 2021-02-12
    59 min

    [NTTR-059]We'll Make Our Male Viewers' Dreams Cum True! With This Amazing Possessed Whistle, You Can Possess The Bodies Of Female Viewers! Do You Want To Deflower An Old Man Cherry Boy!？ Give This Cherry Boy A Graduation And Stream It Live!!

  • riko sato censoredcreampiebig titsNTTRsod createhawk bijutsuknotriNTTR-059NTTR0591nttr00059
    • 2021-02-23
    45 min

    FC2PPV 1698778 ☆ Half-price opening campaign ☆ Outdoors! Reverse offer from a frustrated lewd beautiful mature woman! Creampie SEX while enjoying a feeling of openness!

  • amateur uncensoredfc2
    • 2021-03-24
    20 min

    10musume 032421_01 While She was giving a head, She Ｗet Herself Satomi Kinoshita

  • amateur uncensored10musume
    • 2021-03-24
    49 min

    444KING-032 Honoka (20)

  • amateur censoredcreampiebig titskingking-032king032444king-032
    • 2021-03-26
    231 min

    [GIGL-643]Swinging Couple Swap Shameful Amateur Wives Get Loads Shot On Their Faces And Creampied In Front Of Their Husbands

  • censoredbig titsGIGLgigolo gigologigoloGIGL-643GIGL643h-860gigl00643
    • 2021-04-26
    31 min

    FC2PPV 1788903 Limited number [Appearance] Prefectural. Athletic Club ② Fair-skinned pure girl. Remove the promised rubber at the hotel …

  • amateur uncensoredfc2
    • 2021-05-03

    FC2PPV 1799597 First shot! !! Limited number [Uncensored] A certain famous beauty salon half-type beauty stylist Rainy day nasty. 2 times vaginal cum shot (feature)

  • amateur uncensoredfc2
    • 2021-05-07
    120 min

    [FSDSS-219]Reproductive Bodies Lusting After Each Other Instinctual Sex Complete Unedited Recording Momo Honda

  • honda peach censoredsquirtinglingerieFSDSSfalenokei isoifaleno starFSDSS-219FSDSS2191fsdss00219
    • 2021-05-14
    144 min

    [YMDD-230]Beautiful Hostess's Go To Hot Spring Sex Plan Includes Ultimate Tongue Kissing, Full Body Licking, And Creampie Sex Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsYMDDmomotaro eizohimu lockwakamomoYMDD-230YMDD230ymdd00230
    • 2021-05-15
    244 min

    [KSBJ-136]Well-Shaped Big Ass With A Tight Waist! Actresses With Beautiful And Sexy Asses 28 Women

  • nao wakana jinguji temple nao censoredKSBJksb kikaku emmanuelleKSBJ-136KSBJ136ksbj00136
    • 2021-05-16
    106 min

    [MXGS-1182]Getting A Clueless Popular Porn Star To Immediately Agree To Sucking And Fucking Aoi Kururugi

  • aoi kururugi censoredcreampiebeautiful girlMXGSmaxingMXGS-1182MXGS1182h-068mxgs01182
    • 2021-05-22
    127 min

    [CEAD-339]I'm A Nympho Masturbator Who's Gone Crazy From Pleasure Ayaka Mochizuki

  • ayaka mochizuki censoredsquirtingmature womanCEADceleb no tomoCEAD-339CEAD339cead00339
    • 2021-05-24
    113 min

    420POW-007 Tenten [Family-friendly child / Reliable older sister / Big tits / Neat / School girls / Beautiful girl] Shock! Swamp girl who has sex until the sun goes down! My boyfriend’s penis is too lively and hyperventilation fainting! Deredere

  • amateur censoredbig titsuniformpowpow-007pow007420pow-007
    • 2021-06-20
    122 min

    [AVSA-171]Instinct Unleashed: Kinky SEX Hikari Sena

  • hikari sena censoredbig titssingle workAVSAavs collector sbuddha davscollector sAVSA-171AVSA171avsa00171
    • 2021-07-07
    83 min

    469G-648 Imadoki Girls’ Yen Exchange (Daddy Activity) Circumstances! Flower

  • amateur censoredcreampiebig titsgg-648g648469g-648
    • 2021-07-20
    119 min

    [VNDS-3370]The Beautiful Married Woman Masturbation Viewing Society VNDS-3360 3370

  • censoredamateurblowjobVNDSstar paradisenext toilet r eVNDS-3370VNDS3370h-254vnds03370
    • 2021-07-20
    72 min

    FC2PPV 1931284 [Aokan] Let’S Have Sex In Nature. I Tried Aokan For The First Time Inexperienced. Virgin Is A Man’S Squirting Due To Too Much Stimulation * It’S The First Cum Swallowing

  • amateur uncensoredfc2
    • 2021-07-30
    117 min

    [BBAN-336]Lesbian Series With Super-Sexy Bunny Girls Who Have Beautiful Legs. Himari Kinoshita. Amu Hanamiya.

  • himari kinoshita himari hanazawa hanamiya amu censoredlesbianBBANbibianBBAN-336BBAN336bban00336
    • 2021-08-14
    130 min

    [BBTU-018]Big Boobs Training Class In A Secret Room Yukino Nagisa

  • yukino nagi censoredbig titsschoolgirlBBTUdogmatenunore no boinBBTU-018BBTU018bbtu00018
    • 2021-08-20
    119 min

    [DASD-905]The Summer When I Connected Deeply With My Uncle, Starring Alice Nanase

  • alice nanase censoredcreampiebeautiful girlDASDdasmishima rokusaburoDASD-905DASD905dasd00905
    • 2021-08-24
    68 min

    FC2PPV 2069574 * Limited To 3 Days 2980⇒1980 ★ First Shot ☆ Beautiful Legs Squeezed ♥ Black Hair Short ♥ Slender Beauty Satsuki-Chan 23 Years Old ☆ Obedient Rimming & Rich Blowjob ♥ Beauty Body Rebellion Intense Squirrel Cum Shot Sex ♥ * With Bene

  • amateur uncensoredfc2
    • 2021-09-01
    128 min

    [DKWT-017]AV Journey Showcasing Gorgeous Biracial Wife Who Enjoys Extraordinary Masturbation And Then Demands Real Dick. Karina Nishida

  • nishida karina censoredcreampiesquirtingDKWToffice k swakadzumaDKWT-017DKWT01736dkwt00017
    • 2021-09-11
    140 min

    [URKK-044]I Get Fucked And My Tits Are Fondled Every Day By The Lewd Landlord Next Door - Riho Takahashi

  • riho takahashi censoredbig titssingle workURKKunfinishedrolandnyuukon no ichichichiURKK-044URKK044urkk00044
    • 2021-10-07
    149 min

    [SW-805]No Bra On This Big Tits Waitress That Has Her Nipples Poking Out For Full Temptation! Seeing These Tits Will Turn You Into A Repeat Customer For This Lewd Service!

  • censoredbig titsSWswitchcambridgeswitch hibinoSW-805SW8051sw00805
    • 2021-10-09
    114 min

    [MEAT-036]Amateur Videos of an Ass Lover. My Sexy and Cute Female Sex Friend Drains Me of My Sperm. Waka Misono

  • misono waka censoredbig titsschoolgirlMEATbig the nikumichi mousozokuMEAT-036MEAT036meat00036
    • 2021-10-09
    181 min

    [SQIS-059]Girls Who Do It With Their Stepparents, Vol. 2. I...Have Sex With My Stepfather.

  • censoredbig titsmature womanSQISfa pro platinumfa proSQIS-059SQIS059sqis00059
    • 2021-10-11
    53 min

    541AKYB-013 Yuma (19) Medium ○ In An F Cup Black Hair Beautiful Girl With Little Experience ♪ (Mayumi Okino)

  • amateur censoredamateurbeautiful girlakybakyb-013akyb013541akyb-013
    • 2021-10-23
    149 min

    [NSFS-035]With That Annoying Person... -Wife Stolen, Both Body And Heart- Mami Nagase

  • asami nagase censoredsingle workdramaNSFSnagae styletomitake taroNSFS-035NSFS035nsfs00035
    • 2021-10-28
    125 min

    [AARM-029]AJOI Ultimate Total POV Masturbation Support DVD Original 2 Aromatic Jerk Off Instruction

  • chiharu miyazawa arimura nozomi censoredanalAARMaroma kikakusatoshimaniaaromaAARM-029AARM029aarm00029
    • 2021-10-29
    111 min

    [ADN-351]Weekends Only, Wife Swapping. Nights When My Wife Has Sex With Another Guy

  • airi kijima ayano kato censoreddramaADNattackersmaeda bungouotona no dramaADN-351ADN351adn00351
    • 2021-12-01
    120 min

    [HDKA-246]Nude Maid. Nude Maid Referral Office. Ena Satsuki

  • ena satsuki censoredcreampiebig titsHDKAplanet plusdirector orafu shukoHDKA-246HDKA246h-237hdka00246
    • 2021-12-03
    74 min

    328HMDN-432 [Teacher License Deprivation] At The End Of School, Look For A Man With An App Dirty Talk Barrage Big Ass Cowgirl Cun Slut Play & Demon Egg Piston Conceived Fuckin! !! [Adult Rebellious Period] (Miki Sunohara)

  • amateur censoredcreampiemarried womanhmdnhmdn-432hmdn432328hmdn-432
    • 2021-12-11
    197 min

    [DGCEMD-097]*For Streaming Editions Only! Cums With Bonus Footage* A Maid Will Lure You To Temptation In Her Thong! Mina Kitano A Horny Maid Will Milk You Of Your Semen With Her H-Cup Colossal Tits And Her Thong-Strapped Ass!

  • mina kitano censoredcreampiebig titsDGCEMDceleb no tomoDGCEMD-097DGCEMD097dgcemd00097
    • 2021-12-19
    17 min

    10musume 121921_01 Secret Pussy Collection: Aki Kawada

  • amateur uncensored10musume
    • 2021-12-25
    125 min

    [ONSG-046]Big Tits Deli Hino Fuwari

  • hino fluffy censoredcreampiebig titsONSGgain corporationONSG-046ONSG046onsg00046
    • 2021-12-25
    133 min

    [APAK-209]"No! I"m Cumming! My Pussy Is Breaking! I"m Telling You, It"s Breaking Apart!" - An Orgasmic Cum Facial Girl - A Beautiful Y********l In Uniform Was Trapped By The Orgy Club, Run By A Gang Of Horny Teachers, And Now She

  • flower hunting censoredcreampieschoolgirlAPAKaurora project annexrkaurora project anexAPAK-209APAK209apak00209



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored