high vision javcensored slut censored amateur




FC2HDKADTTSSISMIDVSHKDSQTEMILKHNDIPXRBDDASDBLKVENXCJODAUKGVEMAMVSDJULFSDSSGVH

2020-11-28
118 min

[MIDE-855]She Was Fucked... This Beautiful Office Lady Came To Me For Help, And She Was Dripping Wet And Not Wearing A Bra And I Just Couldn't Resist, So I Fucked Her. Minami Hatsukawa

  • hatsukawa minami censoredcreampiesingle workMIDEmoodyzlamb chopmoodyz divaMIDE-855MIDE855mide00855
    • 2020-11-30
    50 min

    FC2PPV 1589853 [Personal shooting] Appearance / Amaenbomusume Azuki 19 years old / Almost male Inexperienced Lori kid wearing J ○ uniform & white knee highs and cum shot super big dick! !!

  • amateur uncensoredfc2
    • 2021-01-08
    63 min

    FC2PPV 1621184 [Oni is cute no matter where you cut it] Chiharu (20) … I gave it a title that came out quite big, but no, it’s really cute. [With warehousing benefits] [Discount]

  • amateur uncensoredfc2
    • 2021-01-09
    125 min

    [HHKL-079]"It Doesn't Matter How Many Times You Fuck Up... Just Keep Practicing With Me!" My Big Tits Big Stepsister Is Slightly Older Than Me, And She's Helping My Cherry Boy Ass To Become A Man!

  • yano tsubasa mihara honoka censoredcreampiebig titsHHKLhuntervolvo nakanohhh groupHHKL-079HHKL079hhkl00079
    • 2021-01-10
    301 min

    [DVAJ-495]Beautiful Women Wearing Black Pantyhose BEST 5 Hours

  • tsukasa aoi yui hatano censoredDVAJalice japansagi kandaDVAJ-495DVAJ495dvaj00495
    • 2021-01-15
    480 min

    [MBM-258]mpo.jp Presents The Nonfiction Amateur Nampa Seductions Divine Best Hits Collection (A Mature Woman And Her First Experiences With Seduction) 37 Ladies 8 Hours

  • censoredcreampiemarried womanMBMprestigempo selection.committeembmMBM-258MBM258118mbm00258
    • 2021-01-21
    121 min

    [FSDSS-161]Corrupted Into A Slut: Female Teacher Under Mind Fuck Minori Kawana

  • real village henan censoredsingle workFSDSSfalenowild sevenfaleno starFSDSS-161FSDSS1611fsdss00161
    • 2021-01-23
    146 min

    [DASD-801]Teen Pin-Up Who Wants To Become A Model Gets Nailed And Bred By Her Older Producer. Tomoko Kamisaka

  • tomoko kamisaka censoredcreampiebig titsDASDdasrokusaburo mishimaDASD-801DASD801dasd00801
    • 2021-01-23
    148 min

    [JUL-439]Madonna Exclusive: Ai Kano - Second Stage - A K-Cup Sex Symbol's Erotic Awakening - Huge Nipples, Drenched In Pussy Juice, Multiple Orgasms, Passionate Sex.

  • ai kano censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-439JUL439jul00439
    • 2021-02-19
    120 min

    [KSBJ-118]My Brother's Wife - We Were Lovers Once Nene Tanaka

  • nene tanaka censoredcreampiebig titsKSBJksb kikaku emmanuellebito sakuraKSBJ-118KSBJ118ksbj00118
    • 2021-02-21
    145 min

    [JUL-472]Electric Resurrection - Nozomi Tanihara: Ultimate 40-something Married Woman Falls Into Lust And Ecstasy. SEX Special

  • nozomi tanihara censoredmature womansingle workJULmadonnamamezawa mametaroJUL-472JUL472jul00472
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-03-06
    119 min

    [JUL-498]After Getting Continuously Fucked By My Husband's Boss, On The 7th Day, I Finally Lost My Mind ... Chihaya Uzuki

  • chihaya uzuki censoredmature womansingle workJULmadonnatakeshi kogaJUL-498JUL498jul00498
    • 2021-03-19
    59 min

    [315ETQR-209]【妄想主観】麗しの美人OLと濃密性交 Tsumugi

  • amateur censoredcreampieuniformetqretqr-209etqr209315etqr-209
    • 2021-03-27
    58 min

    476MLA-034 [Daddy activity infiltration, Echika-chan edition] Blow face in love ☆ Mekkawa 19 years old Apparel clerk is a sensitive slender body with extremely high face level! Change into obscene lingerie and have convulsions guck gaku big cum! Two

  • amateur censoredcreampieamateurmlamla-034mla034476mla-034
    • 2021-04-09
    120 min

    [MIDE-911]Barely Legal Runaway Tied Up For Ravishment - Breaking In A Confined Teen From Dawn Till Dusk For Days Sakura Miura

  • minamata sakura censoredbig titssingle workMIDEmoodyzmoodyz divaMIDE-911MIDE911mide00911
    • 2021-04-20
    180 min

    [VNDS-7085]Cougar x Big Tits x 10 Women Plump Fleshy Orgasm Sex 180 Minutes

  • censoredcreampiemature womanVNDSstar paradisenext elevenVNDS-7085VNDS7085h-254vnds07085
    • 2021-05-01
    120 min

    [ADN-314]My Precious Girlfriend Of One Month Had Raw Sex With Our Playboy Older Classmate Who I Hate Tsumugi Akari

  • akari tsumugi censoredbeautiful girlsingle workADNattackerskitorune kawaguchiotona no dramaADN-314ADN314adn00314
    • 2021-05-05
    84 min

    435MFC-103 [Future Female Anna Candidate! ] But, in fact, Gonzo with a super carnivorous JD that is a spear man bitch that eats up a man! Whether it’s fingering or electric massage, it blows the tide. !! 2 consecutive rich sexual intercourse of

  • amateur censoredcreampiesquirtingmfcmfc-103mfc103435mfc-103
    • 2021-05-05
    53 min

    Pacopacomama 050521_470 She got a sex toy in her vagina: The sex toy makes her so horny Rina Suzuki

  • amateur uncensoredpacopacomama
    • 2021-05-06
    58 min

    FCP-015 [Delivery only] The best day starting from the morning blowjob Ideal Morning Routine! !! 1

  • amateur censoredamateurbeautiful girlfcpfcp-015fcp015fcp-015
    • 2021-05-07
    169 min

    [MIAA-432]Double Whispering Rejuvenation Chinese Massage Parlor Ichika Matsumoto Yui Nagase

  • ichika matsumoto yui nagase censoredcreampiebeautiful girlMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-432MIAA432miaa00432
    • 2021-05-16
    106 min

    [MXGS-1182]Getting A Clueless Popular Porn Star To Immediately Agree To Sucking And Fucking Aoi Kururugi

  • aoi kururugi censoredcreampiebeautiful girlMXGSmaxingMXGS-1182MXGS1182h-068mxgs01182
    • 2021-05-18
    60 min

    1Pondo 051821_001 My Best Friend’s Girl Friend : Yuka Ohashi

  • amateur uncensored1pondo
    • 2021-05-18
    240 min

    [KIRE-039]Real Life Former High Class Prostitute Remarkable Techniques Of A Woman With Real Experience Mariko Sata

  • mariko sada censoredcreampiesingle workKIREsod createk westbeauty kirei sodKIRE-039KIRE0391kire00039
    • 2021-05-21
    72 min

    FC2PPV 1829435 An 18-year-old beautiful girl who works at her parents’ flower shop. She doesn’t know the dirt yet She enjoys a naive body with whitening breasts. Her face is dyed with a large amount of semen and she is baptized for the firs

  • amateur uncensoredfc2
    • 2021-06-01
    120 min

    [NACR-425]I Couldn't Control My Lust After Seeing My Widowed Step Mother In Sexy Tight Yoga Clothes Mai Kitagawa

  • mai kitagawa censoredbig titsblowjobNACRplanet plusbito sakurananakuruNACR-425NACR425h-237nacr00425
    • 2021-06-10
    121 min

    [RCTD-405]Hermaphrodite House Mother Ryoko Kotona Have A Good Day Today.

  • oda mako kanae lennon censoredbig titslesbianRCTDrocketroute yamazakiRCTD-405RCTD4051rctd00405
    • 2021-07-02
    124 min

    [NKKD-216]Her Husband's Boss Is An Ass Lover... And He's Got His Eye On This Chaste Wife's Perky Booty Yu Shinoda

  • shinoda yu censoredbig titsmature womanNKKDjet eizoNKKD-216NKKD216nkkd00216
    • 2021-07-08
    131 min

    [MOND-217]With My Sister-in-Law Whom I Adore. Yuri Honma

  • really censoredmature womansingle workMONDtakara eizousumineko sanpeidaiichi housouMOND-217MOND21718mond00217
    • 2021-07-11
    240 min

    [270JGAHO-249]息子との中出しがやめられない五十路母 赤城沙代 佐藤君代 狩野あき 菊川佐智江 楢崎百合香

  • amateur censoredcreampiemilfjgahojgaho-249jgaho249270jgaho-249
    • 2021-07-22
    126 min

    [JRZE-064]Entering The Biz At 50! Sanae Hosokawa

  • sanae hosokawa censoredcreampiemature womanJRZEcenter villagejiro fukagawajurakuJRZE-064JRZE064h-086jrze00064
    • 2021-07-31
    125 min

    [DNJR-055]"I Support Your Coming!" A Home-Delivery Supporter of Jacking Off. Mizuki Yayoi.

  • mizuki yayoi censoredbig titsslutDNJRinu mousozokumaboroshi koDNJR-055DNJR055dnjr00055
    • 2021-08-13
    121 min

    [PPPD-955]Spence Breast Development Clinic Kasumi Tsukino

  • kasumi tsukino censoredcreampiebig titsPPPDoppaiPPPD-955PPPD955pppd00955
    • 2021-08-14
    46 min

    404DHT-0092 A Real Virgin Who Captures A Forty Mature Woman! Saya 41 Years Old

  • amateur censoredamateurmature womandhtdht-0092dht0092404dht-0092
    • 2021-09-06
    64 min

    SIRO-4620 [First Shot] [Slender Beauty] [Splattered Lewd Juice] Discover A Beautiful Office Lady Who Has An Obscene Desire That Can Not Be Said To People. Her Sexual Desire Is Released And She Climaxes Many Times In Front Of The Camera .. Application

  • amateur censoredsquirtingamateursirosiro-4620siro4620siro-4620
    • 2021-09-10
    118 min

    [SSIS-171]She Had Kept This Adult Video Performance A Secret But She Never Could Have Imagined That Such A Rabid Fan Would Have Become Her Boss ... Marin Hinata

  • marin hinata censoredsingle workSSISs1 no 1 stylekitorune kawaguchiSSIS-171SSIS171ssis00171
    • 2021-09-11
    52 min

    C0930 ki210911 Reiko Tokuda 58years old

  • amateur uncensoredc0930
    • 2021-09-17
    81 min

    [sqb-119]えま(20)

  • amateur censoredbig titsamateursqbsqb-119sqb119sqb-119
    • 2021-09-25
    151 min

    [APKH-187]Big Tits Girl In School Uniform Encourages Step-brother To Fuck Her In A Love Hotel Sakura Tsuji

  • sakura tsuji censoredcreampiebig titsAPKHaurora project annexhAPKH-187APKH187apkh00187
    • 2021-09-25
    61 min

    1Pondo 092521_001 Glamorous : Momoka Ogawa

  • amateur uncensored1pondo
    • 2021-10-07
    124 min

    [FSDSS-300]The Call Girl I Invite Over Ends Up Being My Bully, Hiyori... Leading To Wild And Crazed Fucking. Hiyori Yoshioka

  • hiyori yoshioka censoredsquirtingbeautiful girlFSDSSfalenonikusonfaleno starFSDSS-300FSDSS3001fsdss00300
    • 2021-10-12
    48 min

    H4610 ki211012 Tomoyo Mizushima 26years old

  • amateur uncensoredh4610
    • 2021-10-28
    53 min

    FC2PPV 2380985 [New Work, Half Price! ] ♀ 201 Female College Student Mi ◯ -Chan 19 Years Old, ♀ 265 Miss Kyaba Ai ◯ -Chan 20 Years Old 2nd Time (3p) Conceive Two Top-Class Beautiful Girls At The Same Time! Dirty Little Micro String Swimsuit Kos Cream

  • amateur uncensoredfc2
    • 2021-10-29
    117 min

    [ATID-484]A Really Fat Black Dick Got Thrust Up My Ass... Chiharu Miyazawa

  • chiharu miyazawa censoredsingle workATIDattackershaga eitarouin madATID-484ATID484atid00484
    • 2021-11-05
    162 min

    [FFFS-033]Bringing Mature Women! Married Women Playing With Other Men"s Cocks! All 30 Voyeur Documents - An Older, Sexually Frustrated Relative Who Commits Obscene Acts With Her Cute Nephew - Natsuki-san, G-cup, 38 Years Old, Auntie Natsue-san, H

  • censoredmature womanslutFFFSprivate mousozokugroupFFFS-033FFFS033fffs00033
    • 2021-11-13
    124 min

    [APNS-264]Going Down For One I Love. Uika Noa Girl Who Went Into Underground Sex Industry For Good For Nothing Senior.

  • squid censoredcreampiesingle workAPNSaurora project annexnasu yukihiroAPNS-264APNS264apns00264
    • 2021-11-13
    100 min

    [SUJI-146]Small Shaved Pussy Creampie~ Fetish Pervert"s Filthy Obscenities~ Rara Kudo 142cm

  • lara kudo censoredcreampiebeautiful girlSUJIkan ran monoSUJI-146SUJI146suji00146
    • 2021-11-19
    214 min

    [REXD-390]The Tables Have Turned! Panty Thief Caught By A Security Guard: "Let"s See You Get Your Clothes Off!"

  • censoredcreampieblowjobREXDredmanji groupREXD-390REXD390rexd00390
    • 2021-12-04
    174 min

    [SORA-348]Kind-Faced Girl"s Release Technique Is Magnificent. Neat and Clean Office Lady With Dick Addiction Will Suck Your Balls Dry Regardless Of Place. 10 Continuous Explosive Releases. Komari Ono.

  • komari ono censoredbig titsblowjobSORAyama to sorahimurokkuSORA-348SORA348sora00348
    • 2021-12-09
    59 min

    Pacopacomama 120921_569 Wives Drink Cum 122: Do You Hate The Fishy Smell!？ Kyoko Moriguchi

  • amateur uncensoredpacopacomama
    • 2021-12-11
    112 min

    [APNS-267]"I"m Sorry I"ve Been Acting Like An Honor S*****t... I"m Really A Masochistic Pervert..." Mashiro Mio

  • mio mashiro censoredcreampieschoolgirlAPNSaurora project annexyukihiro nasuaurora project anexAPNS-267APNS267apns00267
    • 2021-12-17
    120 min

    [MIAA-548]Seductive Female Boss Showing Off Her Ass With Open Crotch Stockings To Invite An Adulterous Office Quickie Yu Shinoda

  • shinoda yu censoredslutsingle workMIAAmoodyzeighteveryone s porn starMIAA-548MIAA548miaa00548
    • 2021-12-24
    168 min

    [SSIS-280]Ayaka Kawakita, The 22-year-old Beautiful And Cute Tutor Who Drives Me Crazy At A Younger Age

  • ayaka hebei censoredhandjobsingle workSSISs1 no 1 stylemichiru arashiyamaSSIS-280SSIS280ssis00280
    • 2021-12-29
    61 min

    [122921-001]Orgy In The Train: Mei Misaka

  • mei misaka uncensoredcreampiehandjobcaribbeancom
    • 2022-01-11
    128 min

    1Pondo 011122_011 Ryo Ikushima Reira Kitagawa: Sexy Actress Special Edition

  • amateur uncensored1pondo



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored